Финансы это совокупность экономических отношений: определение, функции, место и роль в современной рыночной экономике

Содержание

определение, функции, место и роль в современной рыночной экономике

Определение финансов

Определение 1

Финансы (дословно, в переводе с французского «денежные средства») – это совокупность экономических отношений, возникающих в процессе формирования, распределения, а также использования централизованных и децентрализованных фондов денежных средств. Говоря о финансах, чаще всего подразумевают целевые фонды государства, а также фирм (хозяйствующих субъектов)

«Финансы» – это также отрасль знаний (и в частности обязательная дисциплина в экономических ВУЗах), которая изучает соответствующую сферу экономических отношений.

Финансы подразумевают сугубо денежные отношения, а потому данное понятие гораздо уже, чем «экономика». Само слово «финансы» очень часто используется в быту, когда речь идет о деньгах.

Финансы в целом отражают уровень развития производительных сил в экономике, а также возможности их воздействия на макроэкономические процессы.

Классификация финансов

Финансы, традиционно, классифицируют на публичные (государственные и муниципальные, централизованные), а также

частные (или децентрализованные). Частные, в свою очередь включают корпоративные финансы (или финансы предприятий, организаций), финансы домохозяйств (семейные и личные финансы). В рамках корпоративных финансов (из-за особой специфики) выделяются отдельно финансы сферы финансовых услуг (в частности, финансы банков и финансы страховых компаний). Также иногда в рамках корпоративных финансов отдельно выделяют финансы некоммерческих организаций и финансы малого бизнеса.

Особенности финансовых отношений

Финансовым отношениям присущ целый ряд характерных особенностей, которые выделяют их среди других видов экономических отношений. Это в частности:

  • распределительные отношения
  • денежные отношения
  • финансовые отношение в основном связаны с формированием и использованием фондом денежных средств фирм и государства

Функции финансов

Сущность финансов находит свое проявление в функциях. Так, финансы выполняют две основные функции: распределительную и контрольную.

Распределительная функция означает, что финансы участвуют в распределении и перераспределении валового внутреннего продукта.

Контрольная функция подразумевает участие финансов в контроле за наиболее эффективным использованием экономических ресурсов.

Многие исследователи часто выделяют также стимулирующую функцию, финансов, которая связана с воздействием финансовой системы на процессы, протекающие в экономике. Так, например, в процессе формирования доходов бюджетов могут предусматриваться различные налоговые льготы или субсидии для перспективных отраслей промышленности. Основная цель подобного рода мероприятий заключается в стимулировании темпов роста инвестиций в инновации. Помимо этого, в бюджетах различных уровней могут быть предусмотрены расходы, направленные на стимулирование структурной перестройки экономики (например, через финансовую поддержку инновационных и наукоемких технологии, а также наиболее конкурентоспособных производств).

Место и роль финансов в современной рыночной экономике

Роль финансов в условиях рыночной экономики в значительной мере возрастает. Это, в частности, можно объяснить тем, что от финансового положения фирмы будет зависеть ее положение на рынке, долгосрочные перспективы и конкурентоспособность.

В экономике роль финансов достаточно многообразна, но в то же время суть ее можно свести к следующим трем основным направлениям:

  • обеспечение расширенного воспроизводства
  • регулирование социально-экономических процессов
  • стимулирование эффективного использования экономических ресурсов

определение, функции, место и роль в современной рыночной экономике

Определение финансов

Определение 1

Финансы (дословно, в переводе с французского «денежные средства») – это совокупность экономических отношений, возникающих в процессе формирования, распределения, а также использования централизованных и децентрализованных фондов денежных средств. Говоря о финансах, чаще всего подразумевают целевые фонды государства, а также фирм (хозяйствующих субъектов)

«Финансы» – это также отрасль знаний (и в частности обязательная дисциплина в экономических ВУЗах), которая изучает соответствующую сферу экономических отношений.

Финансы подразумевают сугубо денежные отношения, а потому данное понятие гораздо уже, чем «экономика». Само слово «финансы» очень часто используется в быту, когда речь идет о деньгах.

Финансы в целом отражают уровень развития производительных сил в экономике, а также возможности их воздействия на макроэкономические процессы.

Классификация финансов

Финансы, традиционно, классифицируют на публичные (государственные и муниципальные, централизованные), а также частные (или децентрализованные). Частные, в свою очередь включают корпоративные финансы (или финансы предприятий, организаций), финансы домохозяйств (семейные и личные финансы). В рамках корпоративных финансов (из-за особой специфики) выделяются отдельно финансы сферы финансовых услуг (в частности, финансы банков и финансы страховых компаний). Также иногда в рамках корпоративных финансов отдельно выделяют финансы некоммерческих организаций и финансы малого бизнеса.

Особенности финансовых отношений

Финансовым отношениям присущ целый ряд характерных особенностей, которые выделяют их среди других видов экономических отношений. Это в частности:

  • распределительные отношения
  • денежные отношения
  • финансовые отношение в основном связаны с формированием и использованием фондом денежных средств фирм и государства

Функции финансов

Сущность финансов находит свое проявление в функциях. Так, финансы выполняют две основные функции: распределительную и контрольную.

Распределительная функция означает, что финансы участвуют в распределении и перераспределении валового внутреннего продукта.

Контрольная функция подразумевает участие финансов в контроле за наиболее эффективным использованием экономических ресурсов.

Многие исследователи часто выделяют также стимулирующую функцию, финансов, которая связана с воздействием финансовой системы на процессы, протекающие в экономике. Так, например, в процессе формирования доходов бюджетов могут предусматриваться различные налоговые льготы или субсидии для перспективных отраслей промышленности. Основная цель подобного рода мероприятий заключается в стимулировании темпов роста инвестиций в инновации. Помимо этого, в бюджетах различных уровней могут быть предусмотрены расходы, направленные на стимулирование структурной перестройки экономики (например, через финансовую поддержку инновационных и наукоемких технологии, а также наиболее конкурентоспособных производств).

Место и роль финансов в современной рыночной экономике

Роль финансов в условиях рыночной экономики в значительной мере возрастает. Это, в частности, можно объяснить тем, что от финансового положения фирмы будет зависеть ее положение на рынке, долгосрочные перспективы и конкурентоспособность.

В экономике роль финансов достаточно многообразна, но в то же время суть ее можно свести к следующим трем основным направлениям:

  • обеспечение расширенного воспроизводства
  • регулирование социально-экономических процессов
  • стимулирование эффективного использования экономических ресурсов

определение, функции, место и роль в современной рыночной экономике

Определение финансов

Определение 1

Финансы (дословно, в переводе с французского «денежные средства») – это совокупность экономических отношений, возникающих в процессе формирования, распределения, а также использования централизованных и децентрализованных фондов денежных средств. Говоря о финансах, чаще всего подразумевают целевые фонды государства, а также фирм (хозяйствующих субъектов)

«Финансы» – это также отрасль знаний (и в частности обязательная дисциплина в экономических ВУЗах), которая изучает соответствующую сферу экономических отношений.

Финансы подразумевают сугубо денежные отношения, а потому данное понятие гораздо уже, чем «экономика». Само слово «финансы» очень часто используется в быту, когда речь идет о деньгах.

Финансы в целом отражают уровень развития производительных сил в экономике, а также возможности их воздействия на макроэкономические процессы.

Классификация финансов

Финансы, традиционно, классифицируют на публичные (государственные и муниципальные, централизованные), а также частные (или децентрализованные). Частные, в свою очередь включают корпоративные финансы (или финансы предприятий, организаций), финансы домохозяйств (семейные и личные финансы). В рамках корпоративных финансов (из-за особой специфики) выделяются отдельно финансы сферы финансовых услуг (в частности, финансы банков и финансы страховых компаний). Также иногда в рамках корпоративных финансов отдельно выделяют финансы некоммерческих организаций и финансы малого бизнеса.

Особенности финансовых отношений

Финансовым отношениям присущ целый ряд характерных особенностей, которые выделяют их среди других видов экономических отношений. Это в частности:

  • распределительные отношения
  • денежные отношения
  • финансовые отношение в основном связаны с формированием и использованием фондом денежных средств фирм и государства

Функции финансов

Сущность финансов находит свое проявление в функциях. Так, финансы выполняют две основные функции: распределительную и контрольную.

Распределительная функция означает, что финансы участвуют в распределении и перераспределении валового внутреннего продукта.

Контрольная функция подразумевает участие финансов в контроле за наиболее эффективным использованием экономических ресурсов.

Многие исследователи часто выделяют также

стимулирующую функцию, финансов, которая связана с воздействием финансовой системы на процессы, протекающие в экономике. Так, например, в процессе формирования доходов бюджетов могут предусматриваться различные налоговые льготы или субсидии для перспективных отраслей промышленности. Основная цель подобного рода мероприятий заключается в стимулировании темпов роста инвестиций в инновации. Помимо этого, в бюджетах различных уровней могут быть предусмотрены расходы, направленные на стимулирование структурной перестройки экономики (например, через финансовую поддержку инновационных и наукоемких технологии, а также наиболее конкурентоспособных производств).

Место и роль финансов в современной рыночной экономике

Роль финансов в условиях рыночной экономики в значительной мере возрастает. Это, в частности, можно объяснить тем, что от финансового положения фирмы будет зависеть ее положение на рынке, долгосрочные перспективы и конкурентоспособность.

В экономике роль финансов достаточно многообразна, но в то же время суть ее можно свести к следующим трем основным направлениям:

  • обеспечение расширенного воспроизводства
  • регулирование социально-экономических процессов
  • стимулирование эффективного использования экономических ресурсов

Финансы это совокупность денежных отношений, связанных с созданием, распределением и использованием денежных доходов и накоплений на основе распределения и пе

Финансы – это совокупность денежных отношений, связанных с созданием, распределением и использованием денежных доходов и накоплений на основе распределения и перераспределения внутреннего валового продукта и национального дохода.

Фонд – это форма распределения общественного продукта, обусловленная необходимостью выделения и относительного обособления отдельных целевых частей в составе общественного продукта.

Финансы охватывают денежные отношения, которые связаны с формированием и использованием фондов денежных средств участниками хозяйственной жизни. Необходимость создания фондов на различных уровнях обусловлена потребностями субъектов в финансовых ресурсах, обеспечивающих их деятельностью. Эту потребность в ресурсах без финансовых фондов удовлетворить невозможно ни в сфере производства, ни в сфере государственного управления.

Финансы хозяйствующих субъектов и домашних хозяйств состоят из тех фондов, которые формируются на микроуровне, а государственные фонды денежных средств формируются на макроуровне.

К финансовым отношениям экономических субъектов причисляют их отношения с такими институтам:

  • хозяйствующими субъектами при участии в создании продукции и распределении её стоимости на составные элементы, а также распределения прибыли, дивидендов по акциям и т.д.

  • органами государственного управления по платежам различного рода (таможенные пошлины, госпошлина, визовый сбор и т.д.)

  • органами налоговой службы при внесении налогов и других платежей

  • органами муниципального управления при приватизации жилья, земельного участка, при уплате административных штрафов и т.д.

  • банковской системой при получении и погашении кредитов, купле-продажи валюты и ценных бумаг, при депозитных и срочных вкладах и т.д.

  • страховыми компаниями по всем видам страхования.

Сущность финансов как экономической категории отражается в их функциях:

  • Аккумулирующая (или накопительная) функция выражается через процесс образования (накопления, мобилизации) денежных средств, необходимых для функционирования любой хозяйственной системы. На реализации этой функции основана политика доходов.

  • Распределительная функция финансов. Распределение, осуществляемое финансовым методом в сфере материального производства. Функционирует в сфере материального производства, финансы обслуживают кругооборот производственных фондов и участвуют в создании новой стоимости; благодаря им, распределяется реализованная стоимость и формируются доходы, накопления и отчисления; на их основе образуется денежные фонды целевого назначения, предназначенные для удовлетворения разнообразных общественных потребностей. На реализации этой функции основана политика расходов.

ВВП – это стоимость всех товаров, работ и услуг, произведенных на территории данной страны за определенный период времени резидентами данной страны.

1 стадия:

ВВП = фонд возмещения (издержки) + национальный доход (фонд накопления + фонд потребления).


Причины перераспределения НД:

1) наличие непроизводственных сфер

2) межотраслевое и территориальное перераспределение средств

3) необходимость поддержки нетрудоспособных слоев населения

4) несовпадение у хозяйствующих субъектов в отдельные периоды времени доходов и расходов.

2 стадия:

Фонды, создаваемые в процессе перераспределения НД:

1) Фонд обороны

2) Фонд расширенного производства

3) Фонд управления

4) Фонд социально-культурных мероприятий

5) Фонд соц.страха

6) Резервный фонд

  • Контрольная функция финансов тесно связана с распределительной. Она становится возможной поскольку движение всех ценностей и ресурсов в экономике получает свое выражение в денежной форме и отражается в виде денежных показателей. Огромное многообразие финансовых отношений создает условия для контроля над формированием и использованием денежных фондов. Контрольная функция реализуется через механизм финансового контроля. Финансовый контроль – это мероприятия по проверке распределительных процессов при формировании и использовании финансовых ресурсов. Сферой финансового контроля являются все операции, совершаемые с использованием денег.

Виды финансового контроля (по уровню проведения):

1) Общегосударственный и финансовый контроль (МинФин, Счетная палата, Фед.Казначейство, Комитеты Госдумы и Правления и т.д.)

2) Внутриведомственный финансовый контроль. (соответствующие подразделения — контрольно-ревизионные отделы министерств, ведомств)

3) Внутрихозяйственный финансовый контроль. (Бухгалтерия, финансовые службы предприятия и т.д.)

  1. Независимый финансовый контроль осуществляют специализированные аудиторские фирмы и службы.

По времени осуществления разделяют предварительный, текущий и последующий контроль.

По степени охвата:

  • Сплошной и выборочный

  • Тематический и комплексный

  • Полный и частичный

По форме осуществления: анализ, обследование, проверка или ревизия.

Финансовые ресурсы – совокупность денежных средств, создающихся в результате деятельности хозяйствующих субъектов и отдельных физических лиц. Важнейшую роль играет государство, которое не только организует, координирует и контролирует процесс формирования и распределения финансовых ресурсов, но и является постоянным его участником. 3 этапа:

  1. непосредственное создание финансовых ресурсов юридическими и физическими лицами в процессе их производственно-хозяйственной и трудовой деятельности. Источники ресурсов:

    • выручка от реализации продукции и услуг, а также внереализационные поступления юридических лиц

    • основная и дополнительная заработная плата, а также иные доходы физических лиц

Особенность данного этапа в пассивной роли государства, которое практически не принимает участия в процессе непосредственного создания финансовых ресурсов, за исключением малорентабельных и плановоубыточных предприятий.

  1. первичное распределение финансовых ресурсов между их непосредственными создателями и государством. Объектом распределения выступает прибыль, а также некоторые иные результаты деятельности юридических и доходы физических лиц. Инструментом распределения служит налоговая система. В процессе распределения государство решает две параллельные задачи:

  • фискальную: принудительная мобилизация части созданного национального дохода для удовлетворения собственных потребностей государства

  • регулирующую: обеспечивает возможность эффективно корректировать развитие экономической системы общества.

Оставшаяся в распоряжении юридических и физических лиц часть созданных финансовых ресурсов распределяется ими самостоятельно, часть этих ресурсов может быть передана государству на добровольных началах.

3) перераспределение финансовых ресурсов на государственном уровне через систему федеральных, региональных и местных финансов. Мобилизованные в принудительном и привлеченные в добровольном порядке финансовые ресурсы распределяются государством через бюджеты и целевые внебюджетные фонды различных уровней. Лишь незначительная часть собранных средств потребляется государством в лице его органов управления, основная часть возвращается на уровень конкретных юридических и физических лиц.

Финансовая система – это совокупность всех финансовых отношений в стране.

Подсистемы:

1) централизованные финансы (общегосударственные)

    1. гос.бюджет – централизованный фонд денежных средств государства и выражает экономические отношения по перераспределению национального дохода.

    2. внебюджетные фонды – средства Федерального правительства и региональных властей, связанные с финансированием целевых расходов, не включаемых в бюджет. Формирование внебюджетных фондов осуществляется за счет обязательных целевых отчислений, которые имеют налоговую природу.

    3. гос.кредит – отражает кредитные отношения по поводу мобилизации государством временно свободных денежных средств различных субъектов на началах возвратности для финансирования государственных расходов. Особенность государственного кредита заключается в том, что аккумулируемые финансовые ресурсы не участвуют в воспроизводстве материальных ценностей, а используются для покрытия бюджетного дефицита. Обращение государственных долговых обязательств на рынке ценных бумаг служит объектом регулирования со стороны государственных институтов и ЦБ методами кредитно-денежной политики.

    4. фонды имущественного и личного страхования

    5. фондовый рынок

2) финансы предприятия

2.1. государственные

2.2 муниципальные

2.3 акционерные

2.4 арендные

2.5 частные

2.6 общественные

Финансовая политика государства – то совокупность государственных мероприятий, направленных на мобилизацию финансовых ресурсов, их распределение, использование для выполнения государством его функций.

Механизм реализации финансовой политики включает в себя:

1) выработку концепций развития финансовой системы государства.

2) Основные направления использования финансового механизма в эк-й пол-ки гос-ва.

3) составление целевых программ по укреплению общегосударственных и территориальных финансов.

4) разработка конкретных мер по достижению поставленных целей.

ФП: бюджетная пол., кредитная пол., валютная пол., налоговая пол., учетная или дисконтная пол. и пол. по управлению финансами.

Текущая ФП заключается в оперативном регулировании финансового рынка и его звеньев, обеспечение нормального функционирования финансового механизма, поддержание сбалансированного равновесия между звеньями финансовой системы.

Долгосрочная ФП направлена на решение крупномасштабных экономических задач и затрагивает структурные изменения финансовой системы и финансового механизма в перспективе.

Управление финансами – совокупность приемов и методов, направленных на обеспечение развития финансовой системы государства или конкретного субъекта хозяйствования в соответствии с заданными количественными и качественными параметрами.

Уровни управления финансами:

А) общегосударственный

Б) негосударственный

  • уровень корпорации

  • уровень предприятия

  • внутрихозяйственный уровень

Субъекты управления финансами:

    • коллегиальный государственный орган представительной власти соответствующего уровня или собственник конкретного субъекта хозяйствования, определяющие общую финансовую стратегию, приоритеты политики и ключевые финансовые параметры

    • специализированный исполнительный орган государственной власти соответствующего уровня или руководитель финансового направления деятельности конкретного субъекта хозяйствования, формирующие финансовую политику предприятия, принимающие принципиальные решения

    • государственные и негосударственные финансовые службы, осуществляющие оперативное управление финансами

Объекты управления финансами:

    • финансовое направление деятельности государства и конкретного субъекта хозяйствования

    • установленные направления финансовой политики

    • укрупненные финансовые категории результаты деятельности

    • конкретные финансовые показатели

    • органы управления финансами и их персонал

Общие принципы управления финансами:

    • комплексный характер финансовой политики в целом и её элементов

    • сбалансированность доходов и расходов

    • ориентация на оптимизацию финансовых показателей

    • взаимосвязь применяемых методов управления

    • учет специфики переходного периода

Обеспечение системы управления финансами:

  • внешнее (финансовое законодательство и государственные подзаконные акты)

  • внутреннее (собственные регламенты субъекта хозяйствования)

  • информационные массивы (блоки финансовой информации по конкретным направлениям)

  • информационные каналы (процедуры прохождения финансовой информации по инстанциям и рабочим местам)

    • трудовое (сотрудники необходимой специализации и уровня квалификации)

    • инструментальное (совокупность прикладных методов управления финансами)

Финансовое планирование – процесс определения количественных и качественных параметров развития финансовой системы.

Основные направления финансового планирования:

    • стратегическое(перспективное) – направлено на определение общей концепции развития финансовой системы и её укрупненных параметров

    • оперативное (текущее) – направлено на определение конкретных показателей развития финансовой системы на текущий планируемый период

Инструменты финансового планирования:

    • контрольные цифры – значение планируемого показателя, которое желательно достигнуть по завершении планируемого периода

    • финансовые лимиты – предельно допустимое по верхней границе значение планируемого показателя, повышение которого рассматривается как финансовое нарушение

    • экономические нормативы – соотношение между двумя взаимосвязанными показателями, устанавливаемое в процентах или в стоимостном выражении

    • финансовые показатели – конкретные плановые параметры качественного или количественного развития

Прикладные методы финансового планирования:

    • балансовый: взаимоскоординированное планирование доходов и расходов на соответствующий период

    • экстраполяции: определение последующей динамики значения финансового показателя под условием внутренних и внешних условий развития системы

    • программно-целевой6 планирование финансового развития хозяйственной системы по выделенным направлениям

    • математического моделирования: формирование математических моделей процессов развития финансовой системы с последующей подстановкой в созданные алгоритмы

Оперативное управление финансами – процесс практической реализации плановых показателей развития финансовой системы.

Этапы оперативного управления:

    • оперативный анализ текущей финансовой ситуации

    • непосредственное принятие управленческого решения

    • реализация управленческого решения

Прикладные методы оперативного управления:

Направления оперативного управления:

    • корректировка структуры финансовой системы в целом или её элементов

    • маневрирование финансовыми ресурсами

Элементы оперативного управления:

    • информационная база

    • нормативно-методическая база

    • инструментальная база

Некоторые методологические аспекты исследования финансов Текст научной статьи по специальности «Экономика и бизнес»

УДК 336.01

НЕКОТОРЫЕ МЕТОДОЛОГИЧЕСКИЕ АСПЕКТЫ ИССЛЕДОВАНИЯ ФИНАНСОВ

ТЮРНИН ВЛАДИМИР АЛЕКСАНДРОВИЧ

кандидат экономических наук, доцент кафедры «Теория финансов» Финансового университета, Москва, Россия E-mail: [email protected]

АННОТАЦИЯ

В статье рассмотрен ряд аспектов финансов как недостаточно разработанной в современной научной литературе и достаточно сложной экономической категории. По мнению автора, целостное представление о финансах во многом связано с исследованием генетического и функционального аспектов финансов, их единства и взаимодействия. Автором предпринята попытка рассмотрения финансов с генетической точки зрения. Финансы как экономическая категория рассматриваются с разных сторон: как объект и субъект использования (потребления), с точки зрения их природы, их роли как субъекта в общественном воспроизводстве, а также их функционального назначения. Финансы, выступая в качестве синтетической экономической категории, связаны с определенными стадиями процесса воспроизводства на всех уровнях экономики, представляют собой совокупность экономических отношений по поводу формирования, распределения, перераспределения и использования централизованных и децентрализованных фондов, а также нефондовых форм аккумуляции в процессе образования, распределения, перераспределения и использования валового внутреннего продукта и национального дохода государства.

Ключевые слова: финансы как экономическая категория; функции финансов; виды финансов; финансовые потоки; финансовая система.

METHODOLOGICAL ASPECTS OF STUDYING FINANCE

VLADIMIR A. TYURNIN

PhD (Economics), Associate Professor of the Theory of Finance Chair, the Financial University, Moscow, Russia E-mail: [email protected]

ABSTRACT

The article addresses some aspects of finance, a sufficiently complicated economic category that is insufficiently developed in modern scientific literature. According to the author, the holistic view of the finance is closely related to the study of genetic and functional aspects of finance, their interdependence and interaction. The author made an attempt to look on the finance from the genetic point of view. The finance as an economic category is considered from different perspectives: as the object and subject of utilization (consumption), in terms of its nature, its role as a subject in social reproduction, as well as its functionality. As a synthetic economic category, the finance is connected with definite steps of the reproduction process at all levels of the economy, represents a complex of economic relations in terms of formation, distribution, re-distribution and use of centralized and decentralized funds as well as non-fund forms of accumulation in the process of establishment, distribution, re-distribution and use of the gross domestic product and the national income of the state.

Keywords: finance as an economic category; functions of the finance; finance types; finance flows; financial system.

По вопросу о сущности финансов в современной российской экономической литературе сложились две основные теоретические концепции: воспроизводственная и распределительная. Об этих концепциях достаточно подробно написано авторами учебника «Финансы»

[1, с. 151]. Представителями воспроизводственной концепции являются, в частности, Д. С. Моляков, Е. И. Шохин и другие, которые финансы рассматривают как категорию, связанную со всеми стадиями общественного производства [2, с. 9, 22, 26, 28]. Однако наиболее распространенной концепцией

считается распределительная, сторонники которой (В. М. Родионова и другие) возникновение и функционирование финансов связывают лишь со стадией распределения [3, с. 314; 1, с. 15].

Являясь в целом приверженцем взглядов распределительной концепции, вместе с тем хочу отметить, что распределительная концепция финансов требует дальнейшего своего развития. Разновидностью распределительной концепции, как представляется, является позиция ученых, согласно которой финансы — это экономическая категория, совокупность экономических отношений, связанных с формированием, распределением, перераспределением и использованием централизованных и децентрализованных фондов денежных средств в процессе образования, распределения и перераспределения национального дохода. Финансы, являясь важнейшей составной частью рыночных отношений и одновременно основным инструментом реализации экономической политики государства, «рассматриваются как неотъемлемый элемент общественного воспроизводства на всех уровнях хозяйствования — от хозяйствующего субъекта до системы управления национальной экономикой» [4, с. 764].

Соглашаясь с позицией авторов в том, что финансы являются экономической категорией, следует перейти к рассмотрению функций финансов как специфических способов выражения их сущностных черт. В экономической литературе имеет место большое количество этих функций и их названий. Это, видимо, связано с той ролью финансов, которую они играют в воспроизводственном процессе. Роль финансов, несомненно, шире, чем их функции. Как полагает большинство российских экономистов, «сущность финансов выражается через распределительную и контрольную функции» [1, с. 17]. Действительно, участие финансов в процессе распределения почти ни у кого не вызывает сомнения. Что же касается контрольной функции, то ее как функцию финансов не следует смешивать с финансовым контролем, который является одной из функций управления, а поэтому не может выражать сущность

финансов как экономической категории. Как справедливо подчеркивается авторами учебника «Финансы» [1, с. 20], финансовый контроль — это конкретная функция соответствующих органов управления, а не экономическая категория. Как представляется, ключевыми функциями финансов могут быть три: распределительная, контрольная, а также аккумулирующая (последнюю еще называют мобилизационной [5, с. 94, 144], или фондообразующей функцией). Однако фондообразующая функция в меньшей степени подходит к названию функции финансов, ибо финансовые ресурсы осуществляются, как будет показано дальше, не только в фондовой, но и также нефондовой форме аккумуляции.

Что же представляют собой финансы? Ответ на этот вопрос не простой. Финансы — это термин, в определении которого, как справедливо отмечается авторами учебника «Финансы», нет единой точки зрения, ибо разнообразие толкования финансов объясняется разными задачами использования этого понятия, различными философскими и экономическими школами [1, с. 16]. Трудность единого понимания категории «финансы» заключается также и в том, что они, как представляется, являются многоаспектной категорией, ибо ее можно рассматривать в правовом аспекте, в политическом плане, наконец, как определенную экономическую категорию. Известно, что категория выражает, оттеняет наиболее существенную качественную особенность изучаемого процесса, предмета (его сущность), поэтому она должна быть наполнена соответствующим содержанием. При определении экономической основы или экономического содержания финансов прежде всего следует исходить из генетической точки зрения. Экономическая теория должна «генетически вывести различные формы», ибо это выведение есть выражение «действительного процесса формообразования в его различных фазах» [6, с. 442]. Финансы как экономическое явление, конечно, не могут появиться на пустом месте. Они возникают прежде всего в определенных материальных условиях и по своей сути являются отражением или проявлением

условий, продуктом или результатом общественного производства. Поэтому первым аспектом исследования финансов должно быть рассмотрение их как возможности и необходимости воспроизводства определенных экономических условий. Несмотря на то что возникновение финансов и финансовых отношений исторически связано с появлением товарно-денежных отношений и государственности, главная роль в формировании финансов все же принадлежит общественному производству, находящемуся на известном уровне развития. Так, в ХК в. у экономистов-исследователей еще не было достаточных оснований для изучения природы финансов из-за неразвитости финансовых отношений экономики того исторического периода.

Финансы органически связаны с экономической деятельностью людей. Эта связь выражается в том, что финансы проявляются и реализуются в процессе общественного воспроизводства. На первой стадии процесса общественного воспроизводства создается новый продукт (новая стоимость, или ценность). На второй стадии процесса воспроизводства происходит распределение созданной стоимости общественного продукта по целевому назначению и субъектам хозяйствования через посредство системы финансовых отношений. В экономической истории существует несколько схем распределения общественного продукта. Самая простая схема основана на распределении продукта в материально-вещественной форме. Наиболее гибким механизмом распределения и перераспределения общественного продукта, как представляется, является финансовый.оимость общественного продукта распределяется в денежной форме, или распределение общественного продукта получает форму движения денежных средств. Именно на стадии распределения возникают такие экономические категории, как цена, первичные доходы (заработная плата, прибыль, доходы от собственности), кредит. Прежде всего цена служит экономическим индикатором, благодаря которому стоимость получает денежное выражение и становится объектом распределения. Цена базируется на себестоимости, которая представляет собой совокупность затрат. В состав себестоимости входят средства начисленного износа, принятые называть амортизацией. В качестве составной части себестоимости также выступает заработная плата, которая является неотъемлемой частью общей системы стоимостного распределения и выражает стоимостные отношения по поводу распределения вновь созданной стоимости посредством формирования индивидуальных доходов участников производства и последующего удовлетворения их личных потребностей. В ходе распределения вновь созданной стоимости осуществляются отчисления в централизованные и децентрализованные фонды, определяется необходимость использования ассигнований из централизованных фондов. В процессе стоимостного распределения принимает участие также кредит в случае, если дальнейший процесс производства невозможно финансировать за счет собственных средств. На третьей стадии процесса воспроизводства осуществляется непосредственная реализация продукции. Здесь операции по обмену обслуживаются ценой и деньгами. Именно на базе цены происходит количественное измерение обменивающихся стоимостей, находящихся в товарной и денежной формах. Деньги, являясь всеобщим эквивалентом, выступают посредником в процессе обмена. Вновь созданная стоимость в товарной форме обменивается на деньги и превращается в денежную форму. Таким образом, распределение новой стоимости сопровождается движением денежных средств, принимающих особую форму финансовых ресурсов. Формирование

финансовых ресурсов начинается на стадии распределения (обмена), когда стоимость реализована и в составе выручки от реализованной продукции обособляются такие ее элементы, как амортизационные отчисления, заработная плата, прибыль. Как правомерно отмечается авторами, «в широком смысле финансы представляют собой движение всех стоимостных величин в хозяйственном процессе. Речь при этом идет обо всех формах, включая денежно-кредитные» [7, с. 526].

И наконец, на четвертой стадии процесса воспроизводства происходит потребление конечного продукта общественного производства. Если в процессе личного потребления потребляются товары и услуги, то в процессе производственного потребления происходит потребление товаров, выступающих в качестве средств производства. Производственное потребление дает начало новому циклу процесса воспроизводства.

Следовательно, несмотря на то что финансы в общественном производстве играют обслуживающую роль, тем не менее как экономическая категория они выражают совокупность экономических отношений по поводу распределения (обмена) общественного продукта. Без финансов продукты общественного производства не могут быть распределены, и, в конечном счете, использованы, ибо финансы выступают в качестве неотъемлемого связующего звена между созданием и использованием стоимости общественного продукта. Вместе с тем необходимо отметить, что именно развитие уровня и общественного характера производительных сил определяет развитость отношений между людьми в общественном производстве. Каждому уровню развития общественного производства соответствуют своя собственная система, свой характер и уровень развития финансов. А исторический характер развития финансов означает, что объективные по своей природе общественные финансы модифицируются вместе с изменениями в общественном производстве и всегда приобретают определенную экономическую форму. И с этого момента уже можно говорить не просто о том, что финансы с генетической точки зрения представляют

собой выражение условий воспроизводства, а о том, что они вместе с тем выражают конкретно исторические, существующие в определенных формах экономические отношения между людьми и функционируют как экономическая категория. Выражая необходимость воспроизводства условий общественного производства в определенной экономической форме, финансы с функциональной точки зрения также выступают как наиболее глубокий импульс, движущая сила экономики в наиболее общем, абстрактном виде. Иначе говоря, финансы есть внутренние механизмы («кровеносная система») функционирования и развития общественного производства, посредством которых обеспечивается взаимосвязь производства и потребления в рамках исторически определенной совокупности экономических отношений.

Таким образом, можно сказать, что выработка целостного представления о финансах в значительной мере связана с единством и взаимодействием генетического и функционального аспектов данной экономической категории. При раскрытии содержания финансов как единства генетического и функционального аспектов необходимо рассмотреть эти аспекты (стороны) по отдельности, не абсолютизируя и не упуская каждую из этих сторон. «Взаимодействие исключает всякое абсолютно первичное и абсолютно вторичное; но вместе с тем оно есть такой двусторонний процесс, который по своей природе может рассматриваться с двух различных точек зрения; чтобы его понять как целое, его даже необходимо исследовать в отдельности сперва с одной, затем с другой точки зрения, прежде чем можно подытожить совокупный результат» [8, с. 559].

Финансы как экономическую категорию можно рассматривать с разных сторон. Выбор критерия в аспекте выделения того или иного вида финансов зависит от характера научной проблемы, стоящей перед исследователем в каждом конкретном случае. Так, например, по объекту потребления (использования) финансы подразделяются на производственные и личные. Если первые непосредственно связаны с процессом

производства, то последние — с предметами потребления, предназначенными для воспроизводства рабочей силы в сфере личного потребления. Финансы различаются и по субъектам потребления. Таковыми являются общественные (публичные) и индивидуальные (частные) финансы. К общественным финансам относятся производственные и часть личных финансов, существующих за счет всего общества. Индивидуальные финансы — это такие финансы, которые характеризуют процесс потребления, осуществляемый каждым индивидом. По своему функциональному назначению финансы делятся на государственные и негосударственные.

С точки зрения роли субъекта в общественном воспроизводстве финансы подразделяются на две группы: финансы субъектов хозяйствования, с одной стороны, и, с другой стороны, государственные и муниципальные финансы.

Подобно тому, как деньги по своей природе делятся на товарные (деньги как товар особого рода, или «как всеобщий товар договорных обязательств») [9, с. 483] и нетоварные формы (деньги как эквивалент, но не всегда как всеобщий эквивалент), так и финансы по своей природе, как представляется, делятся на денежные (эквивалентные) и неденежные (безэквивалентные) формы (например, ценные бумаги на фондовом рынке). Первые играют первичную и определяющую роль по отношению ко вторым. Вместе с тем те и другие органически взаимосвязаны. По мере развития общественных производительных сил их взаимосвязь все более усиливается, приобретая социальный характер. На поверхности явлений «финансы», «стоимость», как и другие абстрактные экономические категории, обнаружить невозможно. В повседневной практической деятельности в большинстве случаев можно лишь проследить за разнообразными формами движения финансовых ресурсов (денежных доходов и накоплений), принятых называть финансовыми потоками. Под финансовыми потоками понимается целенаправленное движение финансовых ресурсов, циркулирующих

в финансовой системе, а также между финансовой системой и внешней средой. Это налоговые и неналоговые доходы в бюджет, инвестиции, размещение средств в ценные бумаги, межбюджетные трансферты, использование прибыли организации, выплаты заработной платы и/или доходов от собственности, пенсий, стипендий, социальных пособий, привлечение коммерческими организациями средств для осуществления их деятельности, получение средств некоммерческими организациями для оказания услуг, страховые выплаты и т.д. Эти финансовые потоки перемещаются между государством (государствами), регионами, организациями, домашними хозяйствами. С помощью такого перемещения происходит распределение стоимости валового внутреннего продукта (ВВП), а также национального дохода (НД), в результате этого между субъектами экономики возникают финансовые (валютно-финансовые) отношения. Выступая в качестве сегмента экономических отношений, финансовые отношения образуют финансовую систему. В самом общем виде финансовая система определяется как совокупность взаимосвязанных сфер и звеньев финансовых отношений. Сферы финансовой системы — это финансы субъектов хозяйствования, а также государственные и муниципальные финансы. В более узком смысле финансовая система — это система финансовых институтов, функции и структура которых могут быть определены политикой государства [1, с. 29]. По мнению Р. Мертона, лауреата Нобелевской премии по экономике, фундаментальными предназначениями финансовой системы являются перемещение ресурсов во времени и пространстве, консолидация фондов, управление рисками, извлечение информации для поддержки принятия решений, выравнивание информационной асимметрии, обеспечение платежей в процессе обмена товарами и услугами [4, с. 764]. В современных условиях развития мировой экономики финансовая система имеет, по крайней мере, две модели: рыночную и бюджетную. В финансовой системе рыночного типа ключевую роль в перераспределении

НД играют корпорации (организации), способные к эмиссии ценных бумаг, в ценные бумаги которых вкладывают свои временно свободные финансовые средства юридические и физические лица (США, Великобритания). Для бюджетного типа финансовой системы характерно то, что значительная часть финансовых ресурсов в централизованном порядке перераспределяется через систему бюджетов и государственных внебюджетных фондов (Россия, ряд Скандинавских стран).

В условиях переходного периода к рынку для России характерны следующие особенности финансовой системы: повышение самостоятельности субъектов Российской Федерации и местных органов власти в части организации и регулирования финансовой системы; противоречивый характер развития между федеральными и региональными элементами финансовой системы; становление системы негосударственных финансовых организаций, принимающих участие в процессе перераспределения НД; переход от централизованного государственного управления финансовой системой к ее регулированию с использованием преимущественно экономических методов; нестабильный характер финансовой системы в целом; незавершенность процесса формирования целостного финансового законодательства. Поэтому неслучайно одной из основных приоритетных государственных задач в области финансовой политики на ближайшую перспективу в Российской Федерации является обеспечение сбалансированности, финансовой устойчивости бюджетной системы и развитие системы государственного и муниципального финансового контроля [10, с. 151].

Далее, после рассмотрения финансовой системы, следует перейти к финансовым институтам, которые представлены финансово-кредитными организациями, учреждениями, осуществляющими и регулирующими финансовую деятельность, а также фондовыми и валютными биржами. Они входят в состав финансовой системы, обслуживают и обеспечивают финансовыми ресурсами через централизованные и децентрализованные финансовые фондовые, а также нефондовые

формы аккумуляции, различные сферы и звенья финансовой системы. Если к централизованным фондам относятся бюджеты соответствующих уровней власти, а также государственные внебюджетные фонды, то к децентрализованным фондам — фонды субъектов хозяйствования. В нефондовой форме может осуществляться использование финансовых ресурсов, в частности на выполнение финансовых обязательств перед внебюджетными фондами, страховыми организациями, банками. Здесь следует особо отметить, что в настоящее время проблема целостной системы аккумуляции финансовых ресурсов для любой национальной экономики, как справедливо пишет В.Н. Горелик, является весьма актуальной [11, с. 142].

Таким образом, финансы представляют собой своего рода синтетическую экономическую категорию и отражают уровень развития макроэкономических и микроэкономических процессов. В качестве резюме можно предложить определение финансов как экономической категории, связанной с определенными стадиями процесса воспроизводства на всех уровнях экономики, как совокупность экономических отношений по поводу формирования, распределения, перераспределения и использования централизованных и децентрализованных фондов, а также нефондовых форм аккумуляции в процессе образования, распределения, перераспределения и использования ВВП и НД государства. Финансы выступают в качестве важнейшей составной части рыночных отношений и одновременно являются основным государственным инструментом регулирования экономики. Состояние экономики (национальной экономики или домашнего хозяйства) определяет и состояние финансов. При экономическом спаде состояние финансов ухудшается и, как следствие, появляются взаимные неплатежи, возникают дефициты бюджетов, увеличивается государственный долг. В условиях экономического роста, увеличения ВВП и НД финансы характеризуются стабильностью, они стимулируют прогрессивное развитие общественного производства и повышение качества жизни обществ.

ЛИТЕРАТУРА

1. Финансы: учебник / А. Г. Грязнова, Е. В. Маркина и др. 2-е изд. — М.: Финансы и статистика; ИНФРА-М., 2010.

2. Моляков Д. С., Шохин Е. И. Теория финансов предприятий. — М.: Финансы и статистика, 2000.

3. Финансы: учебник / В. М. Родионова, Ю. Я. Вавилов и др. — М.: Финансы и статистика, 1993.

4. Курс социально-экономической статистики: учебник / под ред. М. Г. Назарова. — М.: Омега-Л, 2010.

5. Современная экономическая теория: учебное пособие / под ред. Н.Н. Думной, И.П. Николаевой — М.: ЮНИТИ-ДАНА, 2012.

6. Маркс К., Энгельс Ф. Собрание сочинений. 2-е изд. Т. 26, ч. 3. — М.: Гос. изд-во политической литературы, 1959.

7. Экономическая теория. Экспресс-курс. Учебное пособие/коллектив авторов под ред. А. Г. Грязновой, Н.Н. Думной и А.Ю. Юданова. — М.: КноРус, 2010.

8. Маркс К., Энгельс Ф. Собрание сочинений. — Т. 20.

9. Маркс К. Капитал. Критика политической экономии. Т. 1. — М.: Политиздат, 1973.

10. Приоритеты бюджетной и налоговой политики (материалы расширенного заседания коллегии Министерства финансов «Об итогах исполнения федерального бюджета на 2012 год и задачах органов финансовой системы Российской Федерации на 2013 год» // Финансы. — 2013. — № 4; Бюджетное послание Президента Российской Федерации Федеральному Собранию от 13 июня 2013 г. «О бюджетной политике в 2014-2016 годах»).

11. Горелик В. Н. Финансы: Система движения денег: Монография. — М.: РИОР, ИНФРА-М, 2012.

REFERENCES

1. Gryaznova A. G., Markina E. V. et al. Finansy [Finance]. 2nd ed. Moscow, 2010 (in Russian).

2. MolyakovD.S., Shokhin E.I. Teoriia finans-ov predpriiatii [The theory of corporate finance]. Moscow, 2000 (in Russian).

3. Rodionov V.M., Vavilov Yu. Ya. et al. Finansy [Finance]. Moscow, 1993 (in Russian).

4. Kurs sotsial’no-ekonomicheskoi statis-tiki [Social and economic statistics]. Ed. M. G. Nazarov. Moscow, 2010 (in Russian).

5. Sovremennaia ekonomicheskaia teoriia [Modern economic theory]: Ed. N.N. Dum-naya, I.P. Nikolaeva. Moscow, 2012 (in Russian).

6. Marx K., Engels F. Collected Works. 2nd ed. Vol. 26, Part 3. Moscow, 1959 (in Russian).

7. Ekonomicheskaia teoriia. Ekspress-kurs [Economic theory. Express Course]. Group of authors, ed. A.G. Grjaznova, N.N. Dum-naya, A. Yu. Yudanova. Moscow, 2010 (in Russian).

8. Marx K., Engels F. Collected Works. Vol. 20 (in Russian).

9. Marx K. Kapital. Kritika politicheskoi ekonomii [Capital. Critique of Political Economy]. Vol. 1. Moscow, 1973 (in Russian).

10. Priorities of fiscal and tax policy (materials of expanded meeting of the Ministry of Finance «On the results of federal budget execution for 2012 and the tasks of the financial system of the Russian Federation in 2013». Finansy [Finance], 2013, no. 4; Presidential Address to the Federal Assembly dated June 13, 2013 «On fiscal policy in 2014-2016») (in Russian).

11. Gorelik V.N. Finansy: Sistema dvizheniia deneg [Finance: Money Flow System]. Moscow, 2012 (in Russian).

Елена Владимировна Панина,

председатель Московской конфедерации промышленников и предпринимателей, депутат Государственной думы У1 созыва от партии «Единая россия», доктор экономических наук.

ПУСТЬ ШИРИТСЯ КРУГ ДРУЗЕЙ УНИВЕРСИТЕТА

— Елена Владимировна, какие самые яркие воспоминания у вас остались от учебы в финансовом институте?

— Безусловно, ярких событий и историй за годы учебы случилось великое множество. Поделюсь одним воспоминанием. Был у нас такой предмет — «Финансы СССР», и я пришла сдавать по нему зачет, ну, скажем так, не совсем подготовленной. Сами понимаете: студенческая жизнь — дело такое… Подходит моя очередь отвечать, преподаватель меня вызывает и просит рассказать о том, что из себя представляют финансы СССР. Я бодро начинаю отвечать, что Советский Союз образован 30 декабря 1922 года, численность населения более двухсот миллионов человек. Преподаватель пытается вернуть меня ближе к теме, но сбить меня не так-то просто. Говорю ему: «Да-да, профессор, сейчас»,- а сама продолжаю гнуть ту же линию: «Протяженность границ Советского Союза составляет более 60 тысяч километров», ну и так далее. Тут он меня останавливает и, обращаясь к аудитории, говорит: «Вот, товарищи, эта студентка хорошо знает историю СССР, его географию и культуру, но совершенно ничего не знает про финансы СССР. Но за эрудицию — зачет».

Что же касается того, что мне в дальнейшем пригодилось из полученных за годы учебы знаний, то, как это ни покажется кому-нибудь странным, мне очень помогло знание бухгалтерского учета. Надо сказать, сам этот предмет я не любила — больно уж он нудный, казалось, понять и выучить все это просто невозможно. Но куда деваться — факультет финансово-экономический и бухучет был у нас одним из главных предметов, так что приходилось себя заставлять. Но в дальнейшем знание этого предмета мне очень помогло. Любую, даже самую сложную и многофакторную проблему он помогает разделить в уме по счетам, что-то отнести в дебет, что-то — в кредит и в итоге правильно свести баланс. А казалось бы — никакого отношения ни к политической, ни к парламентской деятельности бухучет не имеет.

— Что бы Вы хотели пожелать университету в связи с его юбилеем?

— На самом деле очень сложно что-то желать учебному заведению, у которого, по сути, все есть. Есть прекрасные руководители, умнейшие преподаватели, талантливые студенты, для которых введена масса специальностей, по которым они могут обучаться. Да и с внеучебной деятельностью все хорошо: жизнь кипит, работают политклубы, прекрасная художественная самодеятельность, ничуть не хуже профессионалов. Все это результат того, что в университете общими усилиями сложился прекрасный коллектив. И неотъемлемая часть этого коллектива — выпускники нашего университета. Вообще клубы выпускников, навсегда сохранивших трепетное чувство к своей aima mater, явление нередкое. Широко известны, например, клубы выпускников Гарварда (даже в России такой есть). По сути, у нас, выпускников финансового института, тоже сложился клуб единомышленников, объединяющий тех, кто, работая на самых разных направлениях и на самых разных, даже очень высоких, должностях, помнит: многому, чего достиг в этой жизни, он обязан своему родному вузу. И я хотела бы пожелать, чтобы этот круг единомышленников становился все шире и мощнее, объединяя свои усилия на благо и нашего родного университета, и всей России.

Финансы 2 (стр. 1 из 19)

Тема 1. Сущность, функции и роль финансов

План лекции:

Понятие финансов

Роль финансов в процессе расширенного воспроизводства

Функции финансов

Взаимодействие и взаимосвязь стоимостных экономических категорий (ценой, оплатой труда, кредитом)

Понятие финансов

Финансы – это экономическая категория, а любая экономическая категория выражает определенные экономические отношения. Финансовые отношения имеют целый ряд особенностей по сравнению с другими экономическими отношениями:

Денежные отношения;

Распределительные отношения;

Связаны с формированием и использованием фондов денежных средств государства и хозяйствующих субъектов.

Эти особенности позволили выделить финансовые отношения из общей массы экономических отношений.

Финансы – это совокупность экономических отношений отражающих формирование и использование фондов денежных средств в процессе их кругооборота.

Как стоимостная категория финансы выражают экономические отношения, связанные с распределением общественного продукта и образованием денежных доходов, фондов направляемых на удовлетворение потребностей хозяйствующих субъектов, государства. Финансы охватывают лишь те экономические отношения которые связанные с формированием и использованием децентрализованных и централизованных фондов.

Понятие «финансы» охватывает обширную область экономических отношений, связанных с формированием и использованием централизованного фонда денежных средств государства.

Таким образом, предметом науки о финансах являются, экономические отношения связанные с распределением общественного продукта.

Объектом финансов являются — целевые денежные фонды, доходы. Субъектом финансов являются предприятия, организации, население, государство.

Термин финансы произошел от латинского «finis» — конец, финиш, окончание платежа, расчет между субъектами экономических отношений (первоначально в Древнем Риме между населением государством). Позже термин трансформировался «financia», применявшийся в широком смысле как денежный платеж, а затем как – совокупность доходов и расходов государства и любых хозяйственных единиц, их комплексов.

Авторство термина «финансы» приписывается французскому ученому Ж. Бодену, который в 1577 г. издал работу «Шесть книг о республике».

Первым автором работы о финансах был Ксенофонт (430-365гг. до н.э.) « О доходах Афинской республики».

У Аристотеля (384-322 гг. до н.э.) воззрения в области финансов изложены в работе «Афинское государственное устройство».

Но не всякая денежная операция относится финансовой, поскольку деньги опосредуют движение всей стоимости общественного продукта, которое осуществляется при помощи разных экономических категорий – цена, оплату труда, финансов, кредита, страхование и д.т..

В иерархии общественных отношений денежные отношения относятся к экономическим, которые в свою очередь, включаются в производственные отношения – определяющую часть системы общественных отношений (см. схему 1.1). Отсюда следует, что финансовые отношения это часть производственных отношений они являются базисными.

Схема 1.1 Последовательность отношений в общественной системе

Для понимания сущности финансов в первом случае можно принять за точку отсчета в воспроизводственном процессе (в целом или в индивидуальном кругообороте производственных фондов отдельного хозяйствующего субъекта — производителя) момент разделения стоимости и начала относительно самостоятельного движения денежной ее формы при реализации изготовленной продукции. При заранее обусловленном характере производства формируются пропорции структуры реализуемого продукта на элементы, соответствующие «С», «V» , «т» и образуются соответствующие им фонды денежных средств или накоплений этих средств.

Движение стоимости в экономике можно проследить по этим основным элементам, которые характеризуют главные компоненты стоимости в процессе воспроизводства:

где: Р — совокупный (валовой) общественный продукт;

С — производственные материальные затраты;

V — стоимость необходимого продукта;

m- стоимость прибавочного продукта.

При этом выделяются фонды оборотных средств, амортизационные и другие отчисления (например, на социальные нужды), фонд оплаты труда, доход.

1.1.Роль финансов в процессе расширенного воспроизводства

Финансы — неотъемлемая часть денежных отношений, их роль и значение зависит от того, какое место денежные отношения занимают в экономических отношениях. Однако не всякие денежные отношения выражают финансовые отношения. Финансы отличаются от денег, как по содержанию, так и по выполненным функциям.

Главное назначение финансов состоит в том, чтобы путем образования денежных доходов и фондов обеспечить потребности государства и предприятия в денежных средствах. Финансы — связывающее звено между созданием и использованием национального дохода. Они воздействуют на производство, распределение и потребление. Удовлетворяя потребности, связанные с развитием производства, потребности работника и его семьи, финансы предприятия и домохозяйств обслуживают процесс смены формы стоимости (товарной, денежной).

Финансы государства обслуживают процесс в общегосударственном масштабе, обеспечивая удовлетворение общественных потребностей (оборона, культура, образование, управление и др.) и социальную защиту отдельных групп населения (пособия на безработицу, пособие по беременности и т.д.).

Помимо традиционных функций государство осуществляет функции по регулированию хозяйственных процессов, поскольку через республиканский бюджет перераспределяется более 40% ВВП и 20% совокупного общественного продукта (по Казахстану). Это дает возможность планомерно осуществлять воспроизводственные процессы, финансировать приоритетные направления экономики. Между тем финансирование может быть неэффективным в результате субъективных волевых решений.

Рыночная экономика привела усилению роли финансов. Во-первых, с возникновением новых хозяйствующих субъектов наряду с традиционными возникают новые группы финансовых отношений. Взаимосвязи между ними усложняются. Во-вторых — финансы становятся самостоятельной сферой денежных отношений, приобретают некоторую обособленность. Деньги, как материальная основа финансов, выполняя функцию средства обращения становятся капиталом, т.е. самовозрастающейся стоимостью. В-третьих, происходит снижение роли финансов на микро-уровне и увеличение значения финансов на макроуровне. Переход страны на новые экономические отношения вызвали значительный спад производства, безработицу, социальную и капиталистическую нестабильность, инфляцию и т.д. В этих условиях финансовая политика неустойчива, часть меняется. Вместе с тем вырисовываются следующие тенденции:

финансовые ресурсы концентрируются не. только в бюджете, но и в других фондах — пенсионном, занятости, медицинского страхования;

бюджет в основном пополняется за счет налогов. Основной упор на налог привел еще большему спаду производства. Возникает необходимость совершенствования налоговой системы;

финансирование народного хозяйства из бюджета уменьшилась с 60% до 12%, что свидетельствует о невмешательстве государства на экономику.

1.2. Функции финансов

Сущность финансов проявляется в их функциях. Под функциями понимается та работа, которую выполняют финансы.

В настоящее время наибольшее признание получили 2 основные концепции финансов распределительная и воспроизводственная.

Сторонники первой концепции считают, что финансы возникают на второй стадии общественного воспроизводства — в процессе распределения стоимости общественного продукта в ее денежной форме.

Согласно данной концепции финансы выполняют 2 функции — распределительную и контрольную.

С помощью распределительной функции распределяется и перераспределяется весовой (совокупный) общественный продукт и его важнейшая часть — национальный доход, а также часть национального богатства.

Различают первичное распределения общественного продукта и последующее или перераспределения.

При первичном распределении из общего объема совокупного общественного продукта выделяются фонд возмещения (материальные затраты и амортизационные отчисления) и вновь созданная стоимость — национальный доход, формируются первичные доходы производственной сферы (хозяйствующих субъектов и их работников). Перераспределение — это процесс дальнейшего уже собранного в бюджете части общественного продукта по субъектам хозяйствования, как в отраслевом так и в территориальном разрезе для ведения расширенного воспроизводства и потребления. Та часть государственного фонда денежных средств, которая направляется для расширения производства (прироста производственных фондов), называется фондом накопления.

Следовательно, через распределительную функцию финансы удовлетворяют определенные общественные потребности, которые отражают экономические интересы государства, экономических агентов, путем формирования денежных доходов и расходования средств. Таким образом, через распределительную функцию раскрывается сущность финансов как категории распределения, выявляются экономические отношения, связанные с движением совокупного общественного продукта, его составных элементов в денежной форме и создаются условия для реализации общественного продукта в натурально-вещественном выражении посредством купли-продажи. В итоге должны быть удовлетворены экономические интересы всех участников общественного производства с учетом конкретного трудового вклада и степени участия в общественном производстве.

Представители воспроизводственной концепции рассматривают финансы как категорию воспроизводства в целом, а не одну (распределительную) стадию. Они утверждают, что финансы — это категория производства, поскольку они обслуживают кругооборот производственных фондов (капитала). Финансы — категория обмена, так как при обмене продолжается процесс распределения общественного продукта.

▶▷▶ понятие финансов и финансовой системы шпаргалка

▶▷▶ понятие финансов и финансовой системы шпаргалка
шпаргалка по физике все формулы в таблицешпаргалки по анализ и диагностика финансово-хозяйственной деятельностивсе формулы физики 7-11 класс шпаргалкашпаргалка по информатике переводшпаргалка управління персоналомшпаргалки бухгалтерским проводкамбесплатные шпаргалки на телефон скачатьправовое государство философия шпаргалкашпаргалка по 8 классу математикаконтроль в государственном управлении шпаргалка

понятие финансов и финансовой системы шпаргалка — Шпаргалка — Финансовая система 7 — Финансы ronlorgshpargalkifinansy861112 Cached Шпаргалка : Финансовая система 7 (Финансы) читать онлайн или скачать бесплатно финансов Финансы организаций: понятие, место и роль в финансовой шпаргалкиcomfinansovyiy-menedjment Cached 14 ПОНЯТИЕ ФИНАНСЫ СОЦИАЛЬНО-ЭКОНОМИЧЕСКАЯ СУЩНОСТЬ И ФУНКЦИИ ФИНАНСОВ Сущность и функции финансов 3Общее понятие о финансовой системе государства Лекция 4 Понятие Финансов И Финансовой Системы Шпаргалка — Image Results More Понятие Финансов И Финансовой Системы Шпаргалка images 1 Понятие финансов и их функции — Финансовое право Шпаргалка wwwe-readingclubchapterphp896941Belousov Cached Понятие финансов и их функции Шпаргалка Понятие финансовой деятельности Российской 7 ПОНЯТИЕ, СУБЪЕКТЫ И ОБЪЕКТЫ ФИНАНСОВОЙ СИСТЕМЫ: Финансовую textbooknewsfinansyi-shpargalki_723ponyatie Cached ПОНЯТИЕ , СУБЪЕКТЫ И ОБЪЕКТЫ ФИНАНСОВОЙ СИСТЕМЫ : ПОНЯТИЕ , СУБЪЕКТЫ И ОБЪЕКТЫ ФИНАНСОВОЙ СИСТЕМЫ 91 Понятие финансов и финансовой системы studopediasu14_57136_ponyatie-finansov-i Cached Понятие финансов и финансовой системы При характеристике финансовой системы нельзя 3 ПОНЯТИЕ ФИНАНСОВОЙ СИСТЕМЫ: Финансовая система — это книгиnamefinansyi-shpargalki_723ponyatie Cached Структуры финансовой системы и органы управления финансовой системой 2 Понятие бюджетного права: предмет, место в системе финансового права Шпаргалка по финансам и — textbooknews textbooknewsshpargalki-finansyishpargalka Cached ФИНАНСЫ КАК ЭКОНОМИЧЕСКАЯ КАТЕГОРИЯ 3 ФУНКЦИИ ФИНАНСОВ 4 РОЛЬ ФИНАНСОВ В СИСТЕМЕ РЫНОЧНОГО ХОЗЯЙСТВА 5 ПОНЯТИЕ И РОЛЬ ФИНАНСОВЫХ РЕСУРСОВ 6 ШПАРГАЛКА: Финансовая система РФ: структура, особенности gosi14blogspotcompblog-page_71html Cached Механизм финансовой системы РФ включает в себя планирование финансов , организацию выполнения финансовых планов, стимулирование их выполнения и финансовый контроль 3 ПОНЯТИЕ ФИНАНСОВОЙ СИСТЕМЫ Финансы: Шпаргалка wwwk2x2infoshpargalkifinansy_shpargalkap3php Cached ПОНЯТИЕ ФИНАНСОВОЙ СИСТЕМЫ и физических лиц Каждое звено финансовой системы выполняет 1 Понятие финансов и финансовой системы: Финансы это economylitonlineobschie-rabotyi_719ponyatie Cached Понятие финансов и финансовой системы Финансы это система экономических отношений по образованию, распределению и использованию фондов денежных средств в процессе распределения и Promotional Results For You Free Download Mozilla Firefox Web Browser wwwmozillaorg Download Firefox — the faster, smarter, easier way to browse the web and all of 1 2 3 4 5 Next 37,200

  • содержание государственного аппарата
  • Все Ещё 1 3 ПОНЯТИЕ ФИНАНСОВОЙ СИСТЕМЫ Финансы in
  • fowikireadingru 86972 Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте 3 поня

ещё с сайта Пожаловаться Информация о сайте 3 понятие финансовой системы Финансовая система это совокупность блоков, звеньев, подзвеньев финансовых Г

тие финансовой системы Финансовая система это совокупность блоков, звеньев, подзвеньев финансовых Государственные финансы отражают экономические отношения по формированию и использованию централизова

  • easier way to browse the web and all of 1 2 3 4 5 Next 37
  • распределению и использованию фондов денежных средств в процессе распределения и Promotional Results For You Free Download Mozilla Firefox Web Browser wwwmozillaorg Download Firefox — the faster
  • особенности gosi14blogspotcompblog-page_71html Cached Механизм финансовой системы РФ включает в себя планирование финансов

понятие финансов и финансовой системы шпаргалка Все результаты Понятие финансов и финансовой системы Финансы это Понятие финансов и финансовой системы Финансы это система экономических отношений по образованию, распределению и использованию ПОНЯТИЕ ФИНАНСОВОЙ СИСТЕМЫ Финансы Шпаргалка wwwkxinfoshpargalkifinansy_shpargalkapphp Похожие Блоки финансовой системы РФ государственные финансы ; финансы юридических и физических лиц Каждое звено финансовой системы Понятие финансов и финансовой системы РФ СтудопедияОрг Вопросы к семинарским занятиям Семинар Бюджетное устройство Российской Федерации Структура бюджетной системы Российской Понятие финансов и финансовой деятельности Основные Шпаргалки по финансовому праву Финансы в экономическом смысле представляют собой совокупность экономических отношений, возникающих в процессе собирания, распределения и ШПАРГАЛКА Финансовая система РФ структура, особенности gosiblogspotcompblogpage_html Похожие Механизм финансовой системы РФ включает в себя планирование финансов , организацию выполнения финансовых планов, стимулирование их Тема Финансовая система ФС понятие, элементы, основы Банковское дело шпаргалка Шевчук Денис Александрович Основой финансовой системы являются финансы предприятий они непосредственно ЛЕКЦИЯ Финансовая система Финансы конспект лекций Финансы конспект лекций Котельникова Екатерина Понятие финансовая система является развитием более общего понятия финансы ФИНАНСОВАЯ СИСТЕМА И ЕЕ СТРУКТУРА Шпаргалка по ФИНАНСОВАЯ СИСТЕМА И ЕЕ СТРУКТУРА Шпаргалка по финансам и кредиту, Общегосударственные финансы это централизованные фонды Книга Шпаргалка по финансам Ereadingclub Основой финансового механизма и целью финансовых отношений является Они являются источником и регулятором финансовой системы В этих бюджетах составляемых на лет есть определенные понятия в виде Финансы Шпаргалка , страница Учебные материалы Сущность финансов Функции финансов Роль финансов в расширенном воспроизводстве Финансовая система Звенья финансовой системы и Финансы, деньги, кредит Шпаргалка Налоговая система как Шпаргалка Налоговая система как составляющая часть финансовой системы Ю Е Короткова, Понятие и функции финансового рынка Финансы Шпаргалка кратко, самое главное Diagramcomua wwwdiagramcomuainfokonspektishpargalkikonspektishpargalkishtml Понятие финансовая система является развитием более общего понятия Финансы имеют свою особенность в каждом звене финансовой системы Финансовая система и ее структура Grandars wwwgrandarsru Финансы Финансовая система Похожие Финансовая система совокупность финансовых отношений, Лекции по Финансам В свою очередь строение финансов властных структур можно Система финансов и Финансовая система, Фонды автор ЕВ Покачалова Цитируется Похожие статьи Ключевые слова финансовая система , система финансов, финансовые ресурсы, и понятий финансового права, к коим относятся система финансов и Грачева ЕЮ, Соколова ЭД Налоговое право Вопросы и ответы Государственные финансы Википедия Похожие Государственные финансы форма организации денежных отношений, участником которых в той или иной форме выступает государство Государственные финансы совокупность экономических отношений, система образования и распределения денежных фондов, Государственные финансы представляют собой часть финансовой Лекция Понятие финансов и финансовой деятельности Финансовые отношения, Функции финансов , Финансовая система , Финансовая Шпаргалка по финансовому праву Республики Беларусь, Понятие и структура финансовой системы Шпаргалкиру shpargalkirunewshtml Финансовая система представляет собой совокупность отдельных сфер Финансы предприятий и организаций представляют собой совокупность Понятие финансов и финансовой системы государства Понятие финансов и финансовой системы государства Скачать готовые ответы к экзамену, шпаргалки и другие учебные материалы в формате Финансовая система принципы построения, структура Конспект ТвояЭкономика Перейти к разделу Понятие финансов и их функции Финансы возникли с появлением государства Само понятие финансов связано с движением Ю Е Короткова, Финансы, деньги, кредит Шпаргалка читать Ю Е Короткова Финансы, деньги, кредит Шпаргалка Рейтинг голоса возникают понятия государственные финансы и государственный бюджет Свой анализ финансовой системы он начинает с государственных Сущность финансов UTMagazineru Похожие мая г Сущность финансов выражается непосредственно в их функциях Понятие и сущность финансов Сущность финансовой системы заключается в совокупности методов, Ответы на самые частые вопросы Шпаргалка Финансы Деньги Кредит Вигман СП СОДЕРЖАНИЕ Глава ПОНЯТИЕ , СУЩНОСТЬ И ФУНКЦИИ ФИНАНСОВ ФИНАНСОВАЯ СИСТЕМА Определение и сущность финансов Государственные и муниципальные финансы Шпаргалка MyBook финансы Шпаргалка автора Виктор Сергеевич Алексеев Простая регистрация на сайте Сущность финансовой системы Финансы Понятие финансы неразрывно связано с понятием денежный оборот Денежный Финансовая система США Мировая экономика, финансы и wwwglobfinruarticlesfinsystushtm Похожие На странице представлено описание Финансовой системы США влияния на всю мировую экономику и мировые финансы финансовая система США роста, которому противопоказано такое понятие , как дефицит средств Социально экономическая сущность финансов Финансы financybiz Финансы Похожие В современной финансовой и экономической литературе финансы рассматривают как систему социальноэкономических отношений, которые Читать книгу Финансы Шпаргалка, автор авторов Коллектив booksonlinecomuaviewphp?book Книга Финансы Шпаргалка , автор авторов Коллектив В шпаргалке в краткой и удобной форме приведены ПОНЯТИЕ ФИНАНСОВОЙ СИСТЕМЫ Кривонос ЮЕ Финансы и кредит Финансовая система, ее wwwaupru Библиотека Книги Финансы Похожие Конспект лекций Таганрог Финансы неотъемлемая часть денежных отношений, поэтому их роль и значение зависят от того, какое место Понятие финансовая система является развитием общего понятия финансы Финансы Общая характеристика финансовой системы cribsme Понятие финансовая система является развитием более общего понятия Достаточно скачать шпаргалки по финансам и никакой экзамен вам не Шпаргалки по финансам и кредиту institutionescomdownloadlectureshpargalkipofinansamikredituhtml Похожие Содержание финансов и виды финансовый отношений Функции финансов как проявление их сущности Понятие финансовой системы Тема Финансовая система ФС понятие, элементы Xlibyru wwwxlibyrudelovaja_literaturabankovskoe_delo_shpargalkapphp Похожие Тема Финансовая система ФС понятие , элементы, основы построения Основой финансовой системы являются финансы предприятий они PDF финансы Главная страница Удмуртский государственный elibraryudsuruxmluibitstreamhandlepdf?sequence Похожие автор СФ Федулова Цитируется Похожие статьи Понятие финансового рынка и дискуссионные вопросы его структуры Динамика Понятие финансовой системы , ее звенья и элементы История финансов Автор Рейтинг , отзывов Бесплатно Android Обучение Финансовая система и само понятие финансов возникло очень давно Прежде всего, их появление связывают с товарными отношениями, когда Понятие и состав финансовой системы РФ Labexru wwwlabexrupageg_finpravl_html Похожие Понятие и состав финансовой системы РФ, характеристика ее звеньев Финансы составляют целостную систему, включающую несколько Урок Финансовая система и финансовые организации Brain Перейти к разделу Международные финансы Это понятие , характеризующее совокупность международных финансовых ресурсов в их движении LERCru СУЩНОСТЬ ФИНАНСОВ, ИХ ФУНКЦИИ И РОЛЬ В wwwlercru?partarticlesartpage Похожие ПОНЯТИЕ , КЛАССИФИКАЦИЯ И ВОЗНИКНОВЕНИЕ ЦЕННЫХ БУМАГ след Финансы система финансовых , денежных, экономических и Сущность финансов как экономической категории состоит в том, что они служат Словарь финансовых терминов и экономических понятий fingramotaorgservisyslovar Похожие Словарь финансовых терминов и экономических понятий для финансового обеспечения задач и функций государства и местного самоуправления; Свод бюджетов всех уровней бюджетной системы Российской Федерации на Финансы и финансовая система Принципы построения и Принципы построения и функции финансовой системы Исторически плане выделяются понятия финансы , финансовая система , финансовая Финансовая система, особенности финансовой системы Myfinby Словарь банковских терминов Похожие янв г Финансовая система система сбора и распределения денежных средств Особенности финансовой системы Республики Беларусь, понятие , элементы, Правильнее было бы сказать, что финансы государства Шпора финансы Шпоры и шпаргалки shporuarufinansyshporafinansyhtml Шпаргалка финансы Финансовая безопасность государства в системе экономичной безопасности Шпаргалки Финансы Шпора финансы и стал употребляться как понятие , связанное с системой денежных отношений между Общая характеристика финансовой системы Понятие Общая характеристика финансовой системы Понятие финансовая система является развитием более общего понятия финансы Финансы Финансовая система и финансовая политика государства bebiz bebizekonomikaehtml Перейти к разделу Финансы и финансовая система Принципы построения и функции Исторически финансы были связаны с деятельностью государства трактовкой понятия финансы Финансовая система это ФИНАНСОВАЯ СИСТЕМА СТРАНЫ Шпаргалка по финансам В финансовой системе выделяют государственные финансы , финансы субъектов Федерации образует понятие консолидированный бюджет РФ PDF основы финансовой системы госу Высшая школа экономики и hsemsusuruiepmwpcontentuploadssitesKonspektlektsiyOFSGpdf автор ЛА Васильева Похожие статьи Основы финансовой системы государства Конспект лекций как понятие , связанное с системой денежных отношений между населением и Шпаргалка Финансы Деньги Кредит учеб EconomicsStudio Глава ПОНЯТИЕ , СУЩНОСТЬ И ФУНКЦИИ ФИНАНСОВ ФИНАНСОВАЯ СИСТЕМА Определение и сущность финансов Признаки финансов eBOOK Финансы предприятий Шпаргалка Knigacom Финансы предприятий как элемент финансовой системы охватывают В этой связи применяется понятие дисконтированный, или приведенный Финансовое право шпора StudFiles мар г Финансовая система Российской Федерации как совокупность входящих в нее элементов, ее состав Понятие финансового права Содержание финансов Система финансов и финансовая система wwwekonomikastrufkreditfinansifinansihtml Похожие Система финансов и ее звенья, отличие системы финансов от Понятие система финансов следует отличать от финансовой системы Финансовая Не найдено шпаргалка DOC Теория финансов РИНХ Характеристика сфер и звеньев финансовой системы отрыв некоторых трактовок понятия финансов от основных современных финансовых теорий Не найдено шпаргалка Шпаргалка по финансам DamiRocK Похожие Понятие финов, этапы становления и развития финансов второй этап характеризуется узостью финансовой системы , так как она состояла Финансовое право РФ шпаргалка Реферат EUPRU Экономика eupruDocumentsFECasp Похожие Понятие и функции финансов в РФ Понятие и методы финансовой деятельности государства Финансовая система РФ, её структура и развитие Вместе с понятие финансов и финансовой системы шпаргалка часто ищут финансы и финансовая система рф финансы в правовом аспекте понятие финансов и финансовой системы рф понятие финансовой системы финансы это система денежных отношений финансы это кратко государственные финансы понятие финансов финансовое право Документы Blogger Hangouts Keep Jamboard Подборки Другие сервисы

договор страхования условия договора виды договора шпаргалкатаблица неправильных глаголов английского языка шпаргалкойбесплатно скачать шпаргалку по административному правупредставительство шпаргалка гражданское правошпаргалки по педагогике экзаменационные вопросышпаргалка по обеспечению прав человека в деятельности овдпонятие социальной системы шпаргалкакак называют школьники шпаргалкизадачи семейного права шпаргалкабухгалтерский учет и аудит шпаргалки бесплатно

Все Ещё 1 3 ПОНЯТИЕ ФИНАНСОВОЙ СИСТЕМЫ Финансы infowikireadingru › 86972 Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте 3 понятие финансовой системы Финансовая система – это совокупность блоков, звеньев, подзвеньев финансовых Государственные финансы отражают экономические отношения по формированию и использованию централизованных Читать ещё 3 понятие финансовой системы Финансовая система – это совокупность блоков, звеньев, подзвеньев финансовых отношений Блоки финансовой системы РФ: • государственные финансы ; • финансы юридических и физических лиц Каждое звено финансовой системы выполняет свои функции, но вместе они образуют единую финансовую систему страны Государственные финансы отражают экономические отношения по формированию и использованию централизованных фондов денежных средств, предназначенных для обеспечения выполнения государством его функций Государственные финансы включают в себя государственный бюджет и государ Скрыть 2 3 ПОНЯТИЕ ФИНАНСОВОЙ СИСТЕМЫ / Финансы k2x2info › shpargalki/finansy_shpargalka/p3php Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте 3 понятие финансовой системы Финансовая система – это совокупность блоков, звеньев, подзвеньев финансовых Государственные финансы отражают экономические отношения по формированию и использованию централизованных Читать ещё 3 понятие финансовой системы Финансовая система – это совокупность блоков, звеньев, подзвеньев финансовых отношений Блоки финансовой системы РФ: • государственные финансы ; • финансы юридических и физических лиц Каждое звено финансовой системы выполняет свои функции, но вместе они образуют единую финансовую систему страны Государственные финансы отражают экономические отношения по формированию и использованию централизованных фондов денежных средств, предназначенных для обеспечения выполнения государством его функций Государственные финансы включают в себя государственный бюджет и государ Скрыть 3 Шпаргалка по финансам StudFilesnet › preview/926806/ Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте Работа по теме: Шпаргалка по финансам Предмет: Финансы и кредит Финансы — это система экономических (денежных) отношений, с помощью Понятие финансов ассоциируется с процессами , которые проявляются в разных формах и сопровождаются движением денежных средств как в наличных, так и в Читать ещё Работа по теме: Шпаргалка по финансам Предмет: Финансы и кредит ВУЗ: СПбГЭТУ Финансы — это система экономических (денежных) отношений, с помощью которой создаются и расходуются фонды денежных средств Понятие финансов ассоциируется с процессами , которые проявляются в разных формах и сопровождаются движением денежных средств как в наличных, так и в безналичной формах Безналичная форма движения денежных средств проявляется в распределении прибыли, перечислении налоговых платежей, во внесении средств в благотворительные фонды и внебюджетные фонды Скрыть 4 Образовательный портал | 3 ПОНЯТИЕ ФИНАНСОВОЙ geumru › finansy…ponyatie-finansovoy-sistemyiphp Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте 3 понятие финансовой системы Финансовая система — это совокупность блоков, звеньев, подзвеньев финансовых отношений Блоки финансовой системы РФ: государственные финансы ; финансы юридических и физических лиц Читать ещё 3 понятие финансовой системы Финансовая система — это совокупность блоков, звеньев, подзвеньев финансовых отношений Блоки финансовой системы РФ: государственные финансы ; финансы юридических и физических лиц Каждое звено финансовой системы выполняет свои функции, но вместе они образуют единую финансовую систему страны Государственные финансы отражают экономические отношения по формированию и использованию централизованных фондов денежных средств, предназначенных для обеспечения выполнения государством его функций Государственные финансы включают в себя государственный бюджет и государстве Скрыть 5 Шпаргалка : Финансовая система Российской Федерации refetekaru › r-175725html Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте Финансы и финансовые ресурсы понятия не тождественные Финансовая система – это система форм и методов образования, распределения и использования фондов денежных средств государства и предприятий Читать ещё Финансы и финансовые ресурсы понятия не тождественные Финансовые ресурсы сами по себе не определяют сущности финансов , не раскрывают их внутреннего содержания и общественного назначения Финансовые ресурсы страны складываются из трех источников Финансовая система – это система форм и методов образования, распределения и использования фондов денежных средств государства и предприятий В странах с развитой рыночной экономикой основными звеньями финансовой системы являются: государственный бюджет — ведущее звено, так как он является главным инструментом перераспределением национального дохода и основным финансовым планом страны Скрыть 6 Финансы Шпаргалка : кратко, самое главное diagramcomua › info/konspekti-shpargalki… Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте Финансовая система — это система форм и методов образования, распределения и использования фондов денежных средств государства и предприятии Ведущим звеном финансовой системы выступает государственный бюджет Читать ещё Финансовая система — это система форм и методов образования, распределения и использования фондов денежных средств государства и предприятии Ведущим звеном финансовой системы выступает государственный бюджет По своему материальному содержанию это главный централизованный фонд денежных средств государства, главное орудие перераспределения национального дохода Через это звено финансовой системы перераспределяется до 40 % национального дохода страны Из государственного бюджета производятся и основные расходы: на военные цели, развитие экономики, содержание государственного аппарата, социальны Скрыть 7 ШПАРГАЛКА : Финансовая система РФ: структура gosi14blogspotcom › p/blog-page_71html Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте Финансовая система РФ — совокупность различных сфер финансовых отношений, каждая из которых характеризуется особенностями в формировании и использовании фондов денежных средств, различной ролью в общественном воспроизводстве Совокупность различных ф Читать ещё Финансовая система РФ — совокупность различных сфер финансовых отношений, каждая из которых характеризуется особенностями в формировании и использовании фондов денежных средств, различной ролью в общественном воспроизводстве Совокупность различных финансовых отношений, в процессе которых разными методами распределяются фонды денежных средств, хозяйствующих субъектов, домохозяйств и государства Механизм финансовой системы РФ включает в себя планирование финансов , организацию выполнения финансовых планов, стимулирование их выполнения и финансовый контроль Скрыть 8 3 понятие финансовой системы ur-consulru › Bibli/Finansy-SHpargalkahtml Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте 3 понятие финансовой системы Финансовая система – это совокупность блоков, звеньев, подзвеньев финансовых отношений • финансы юридических и физических лиц Каждое звено финансовой системы выполняет свои функции, но Читать ещё 3 понятие финансовой системы Финансовая система – это совокупность блоков, звеньев, подзвеньев финансовых отношений Блоки финансовой системы РФ: • государственные финансы ; • финансы юридических и физических лиц Каждое звено финансовой системы выполняет свои функции, но вместе они образуют единую финансовую систему страны Государственные финансы отражают экономические отношения по формированию и использованию централизованных фондов денежных средств, предназначенных для обеспечения выполнения государством его функций Скрыть 9 Книга: Шпаргалка по финансам e-readingclub › bookreader…Mihaiilova_-_Shpargalka… Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте Подробнее о сайте Автор: Михайлова Н, Книга: Шпаргалка по финансам , Жанр: бизнес 1 СУЩНОСТЬ ФИНАНСОВ Финансы выражают экономические общественные С помощью системы централизованных финансов в РФ перераспределяется около 60 % стоимости ВВП Этот перераспределительный процесс обслуживает Читать ещё Автор: Михайлова Н, Книга: Шпаргалка по финансам , Жанр: бизнес 1 СУЩНОСТЬ ФИНАНСОВ Финансы выражают экономические общественные отношения в связи с образованием, распределением и использованием фондов денежных средств в процессе распределения и перераспределения созданной стоимости Процесс стоимостного распределения общественного продукта, в ходе которого созданная стоимость делится между субъектами хозяйствования по целевому назначению, чрезвычайно сложен С помощью системы централизованных финансов в РФ перераспределяется около 60 % стоимости ВВП Этот перераспределительный процесс обслуживает государственные финансы Скрыть Понятие финансов и финансовой системы Шпаргалка — смотрите картинки Картинки › понятие финансов и финансовой системы шпаргалка 1024×767 832×485 1024×574 1024×767 500×371 1024×767 669×397 1024×767 1024×767 800×600 Ещё картинки Шпаргалка по Финансовому праву — Шпаргалка worksdokladru › view/azdAWKT6jQwhtml Сохранённая копия Показать ещё с сайта Пожаловаться Информация о сайте 2 Понятие и роль финансовой системы Финансово -правовая норма – установленное государством, обеспеченное возможностью применения принуждения и закрепленное в источниках финансового права правило поведения Читать ещё 2 Понятие и роль финансовой системы Система финансового права — это объективно обусловленное системой общественных финансовых отношений внутреннее его строение, объединение и расположение финансово правовых норм в определенной последовательности Наиболее крупные подразделения российского ФП — части: Общая и Особенная Финансово -правовая норма – установленное государством, обеспеченное возможностью применения принуждения и закрепленное в источниках финансового права правило поведения, регулирующее отношения в сфере государственного управления Скрыть Вместе с « понятие финансов и финансовой системы шпаргалка » ищут: финансовая система рф понятие банковской системы система финансового права понятие и формы финансового контроля финансово -правовые нормы и финансовые правоотношения понятие финансовой системы методы финансового контроля формы финансового контроля финансовый контроль принципы построения бюджетной системы 1 2 3 4 5 дальше Нашлось 6 млн результатов Дать объявление Регистрация Войти Браузер с защищённым режимом ускоряет загрузку сайтов и видео 0+ Закрыть Установить Попробовать ещё раз Москва Настройки Клавиатура Помощь Обратная связь Для бизнеса Директ Метрика Касса Телефония Для души Музыка Погода ТВ онлайн Коллекции О компании Вакансии Блог Контакты Мобильный поиск © 1997–2019 ООО « » Лицензия на поиск Статистика Поиск защищён технологией Protect Алиса в Браузере Помогает искать в интернете и поддерживает беседы 0+ Скачать Будьте в Плюсе

ИнтерфейсРусский/Английский/Германский
Тип лицензияFree/Условно-бесплатно
Кол-во просмотров257
Кол-во загрузок132 раз
Обновление:12-04-2019
Оценка:1-109

Изучение взаимосвязи между финансами, институтами и экономическим ростом: данные по экономике стран АСЕАН

В следующем разделе обсуждается используемая эконометрическая модель и обсуждается обоснование используемых переменных и источников данных.

Динамическая панельная оценка

Существует множество методов для изучения влияния финансов и институтов на экономический рост. В этом исследовании изучается экономика стран АСЕАН за определенный период времени, и, таким образом, в этом случае уместен панельный анализ.Во многих предыдущих эмпирических исследованиях экономического роста использовались Barro (1991) или Mankiw et al. (1992) использовали метод регрессии, в то время как другие исследователи эмпирически исследуют рост, дифференцируя производственную функцию Кобба-Дугласа. Подобно предыдущим исследованиям, посвященным росту, в этом исследовании используется транслогичная производственная функция, дополненная финансовыми и институциональными переменными, что позволяет модели быть экономной и обеспечивает более точные выводы (Haini, 2019). Это во многом отличается от многих предыдущих исследований.{1 — \ beta} $$

(1)

Рассмотрим уравнение. (1), который представляет производственную функцию на уровнях (заглавными буквами), где \ (Y \) представляет выпуск валового внутреннего продукта (ВВП), \ (K \) и \ (L \) представляют собой вводимые ресурсы, капитал и труд, соответственно. . \ (A \) и \ (\ beta \) — вектор параметров.

$$ y = \ alpha + \ beta k + \ varepsilon $$

(2)

Уравнение (1) может быть переписано и преобразовано в логарифм для получения уравнения.(2), разделив \ (y \) и \ (k \) на \ (l \). В уравнении. (2), \ (y \) представляет выпуск ВВП на труд, а \ (k \) представляет капитал на труд, а \ (\ alpha \) и \ (\ beta \) — вектор параметров, а \ (\ varepsilon \ ) представляет собой ошибку. Модифицированная производственная функция транслоготипа рассматривается как регрессия в стиле Барро (1991) и позволяет гибко дополнять другие интересующие переменные.

Между тем, уравнение. (3) представляет упрощенную модель производственной функции транслоготипа в виде панели, где наблюдения измеряются в \ (i \) -й стране и во время \ (t \).Зависимая переменная, экономический рост представлен как \ (y_ {it} \), а \ (X_ {it} \) — экзогенный вектор независимых переменных. Термин ошибки \ (\ varepsilon_ {it} \) состоит из зависящей от страны временной инвариантной ошибки \ (\ mu_ {i} \) и идиосинкразической ошибки \ (\ nu_ {it} \), которая предполагается независимые и одинаково распределенные. Кроме того, \ (\ alpha \) и \ (\ beta \) — это вектор параметров. Уравнение (3) можно оценить с помощью обычного метода оценки наименьших квадратов (МНК).

$$ \ begin {align} y_ {it} & = \ alpha + \ beta X_ {it} + \ varepsilon_ {it} \\ \ varepsilon_ {it} & = \ mu_ {i} + \ nu_ {it} \\ \ end {align} $$

(3)

Оценщик OLS относительно прост и понятен и предоставляет базовые результаты для сравнения. Однако оценка МНК может привести к смещению вверх или вниз, поскольку \ (\ mu_ {i} \) не наблюдается и может быть положительно или отрицательно коррелирован с независимыми переменными.В результате есть и другие панельные оценщики, которые можно использовать для контроля эндогенности и получения более эффективных оценок. Следовательно, в этом исследовании используется динамический панельный оценщик, а именно системный GMM-оценщик для контроля эндогенности (Blundell and Bond 1998).

$$ \ Delta y_ {it} = \ beta \ Delta X_ {it} + \ gamma \ Delta y_ {i, t — 1} + \ Delta \ mu_ {it} $$

(4)

Динамическая панель оценки построена на уравнении. (3), где он включает запаздывающую зависимую переменную \ (y_ {i, t — 1} \) в качестве независимой переменной.Это показано в формуле. (4) с вектором параметра \ (\ gamma \). Кроме того, система GMM учитывает первые отличия уравнения. (3) для получения уравнения. (4) и устранить зависящую от страны ошибку, не зависящую от времени \ (\ mu_ {i} \). Что еще более важно, принятие первых разностей эффективно устраняет инструменты в периоде t = 1 и t = 2 и, следовательно, условия моментов GMM системы в уравнении. (5) выглядит следующим образом:

$$ \ begin {align} & E \ left [{y_ {i, t — s}, \ left ({\ mu_ {i, t} — \ mu_ {i, t — 1}} \ right)} \ right] = 0 \ quad {\ text {for}} \, s \ ge 2; \ quad t = 3, \ ldots, T \\ & E ​​\ left [{X_ {i, t — s}, \ left ({\ mu_ {i, t} — \ mu_ {i, t — 1}} \ right)} \ right] = 0 \ quad {\ text {for}} \, s \ ge 2; \ quad t = 3, \ ldots, T \\ \ end {align} $$

(5)

Кроме того, система оценки GMM расширяет моментные условия, так как дифференцирование может дать смещенные оценки, когда инструменты потенциально могут показывать случайное блуждание или сохраняются во времени (Blundell and Bond 1998).В результате, система оценки GMM использует как разности, так и уровни в качестве инструментов, а также моментные условия в уравнении. (5), наряду с дополнительными моментными условиями, представленными в формуле. (6).

$$ \ begin {выровнено} & E \ left [{(y_ {i, t — s} — y_ {i, t — s — 1}) \ left ({\ mu_ {i} — \ mu_ {i , t}} \ right)} \ right] = 0 \ quad {\ text {for}} \, s = 1 \\ & E ​​\ left [{(X_ {i, t — s} — X_ {i, t — s — 1}) \ left ({\ mu_ {i} — \ mu_ {i, t}} \ right)} \ right] = 0 \ quad {\ text {for}} \, s = 1 \\ \ конец {выровнен} $$

(6)

Оценщик GMM системы оценивается с использованием двухэтапной процедуры, и оценочные результаты также обеспечивают надежность и чувствительность коэффициентов, поскольку оба оценщика должны сообщать сравнимые результаты.В исследовании сообщается о надежности инструментов с использованием теста Sargan J на пригодность инструмента и ограничений сверхидентификации (Sargan, 1958). Кроме того, сообщается о тесте Ареллано – Бонда последовательной автокорреляции, чтобы удовлетворить моментным условиям, наложенным в уравнениях. (5) и (6) с нулевой гипотезой об отсутствии автокорреляции во втором порядке (Ареллано и Бонд, 1991). Полная спецификация оценочной модели и переменные обсуждаются в следующем разделе.

Используемые источники данных и переменные

В этом исследовании используются годовые данные из сбалансированного набора панельных данных десяти стран АСЕАН, а именно Брунея, Камбоджи, Индонезии, Лаосской Народно-Демократической Республики, Малайзии, Мьянмы, Филиппин, Сингапура, Таиланда и Вьетнама из период 1995–2017 гг.Страны для выборки были выбраны, поскольку экономики АСЕАН имеют общие цели и задачи посредством региональной интеграции. Кроме того, период времени выборки был выбран на основе доступности данных. Данные для переменных собраны из различных источников, а именно: Penn World Table 9,1 (Feenstra et al. 2015), World Development Indicators (World Bank), World Governance Indicators (World Bank) и База данных индекса финансового развития МВФ (Свиридзенко, 2016).{2} + \ beta_ {7} {\ text {law}} _ {it} \\ & \ quad + \ beta_ {8} ({\ text {fi}} \ times {\ text {law}}) _ {it} + \ beta_ {9} ({\ text {fi}} \ times {\ text {law}}) _ {it} + \ beta_ {10} {\ text {opn}} _ {it} + \ beta_ {11} {\ text {pop}} _ {it} + \ beta_ {12} {\ text {hc}} _ {it} + \ varepsilon_ {it} \\ \ end {align} $$

(7)

Поскольку в исследовании изучается взаимосвязь между финансовым и институциональным развитием и экономическим ростом с использованием производственной функции преобразования, ВВП на рабочую силу, обозначенный как \ (y_ {it} \), является зависимой переменной.ВВП на рабочую силу отражает экономический рост с учетом участия рабочей силы, а не всего населения, в соответствии с теорией производства. Исследование также включает капитал на рабочую силу, обозначенный как \ (k_ {it} \) в качестве одной из независимых переменных, в соответствии с теорией производства, где увеличение основного капитала на рабочую силу отражает увеличение инвестиций, которые могут привести к дальнейшему росту (Solow 1956). Временной тренд включен для учета технического прогресса, не зависящего от Хикса, как часть модели производственной функции транслога.Между тем, уравнение. (7) также включает другие независимые переменные, которые включают финансовую структуру, институциональное развитие и контрольные переменные.

В данном исследовании используются две переменные финансового развития, предложенные Свиридзенко (2016). Традиционные переменные финансового развития обычно измеряют финансовую глубину, например отношение M2 к ВВП (King and Levine, 1993) или отношение банковского кредита к ВВП (Levine, 1997). Хотя эти традиционные переменные подчеркивают роль финансовых институтов, они не принимают во внимание сложный характер финансового развития.Кроме того, эти переменные отличаются от традиционных рыночных переменных финансового развития, использованных в предыдущих исследованиях, основанных на сравнении банковских и рыночных исследований (Beck and Levine, 2002), в которых не учитываются другие аспекты финансового развития. В результате в этом исследовании используется индекс для финансовых учреждений, обозначенный как \ ({\ text {fi}} _ {it} \), и индекс для финансовых рынков, обозначенный как \ ({\ text {fm}} _ {it} \), что позволяет исследовать различия в финансовых структурах (Свиридзенко, 2016).Считается, что используемые индексы финансовых институтов и финансовых рынков полностью отражают финансовое развитие экономики, поскольку они учитывают глубину, доступность и эффективность финансовых институтов и рынков.

Предыдущие эмпирические исследования финансовых структур обычно используют переменные, отражающие финансовую глубину, такие как отношение частного кредита к ВВП (King and Levine 1993) и капитализация фондового рынка (Beck and Levine 2002).Хотя это приемлемо, финансовое развитие — это многоплановый процесс, и развивались финансовые секторы, в которых как финансовые учреждения, так и рынки могут выполнять основные функции финансов в экономике. Помимо финансовой глубины, не менее важны доступность и эффективность финансирования, поскольку недоступное финансирование приведет к альтернативным издержкам, а неэффективные финансовые системы расточительны (Свиридзенко, 2016). В результате использование индексов обеспечивает более полную переменную для финансовых институтов и рынков в странах АСЕАН и предлагает более глубокое понимание роли различных финансовых структур в экономическом росте.{2} \), соответственно, поскольку ряд недавних эмпирических исследований показывают, что финансовое развитие является нелинейным (Breitenlechner et al. 2015; Rousseau and Wachtel 2011).

Помимо переменных финансовой структуры, это исследование включает переменную институционального развития для изучения влияния институтов на экономический рост. Точно так же институциональное развитие — это сложная многомерная концепция, и во многих предыдущих эмпирических исследованиях использовались многочисленные переменные, чтобы отразить природу институтов.В этом исследовании используется переменная институционального развития, представленная в Индикаторах мирового управления (Всемирный банк), а именно индекс верховенства закона, обозначенный как \ ({\ text {law}} _ {it} \). Индекс верховенства закона измеряет качество исполнения контрактов, права собственности, правоохранительные и судебные органы (Кауфманн и др., 2010). Хорошо известно, что страны с плохими правовыми институтами не получают эффективных выгод от политики финансовой либерализации и, таким образом, достигают меньшего экономического роста (La Porta et al.1998). Кроме того, верховенство закона может использоваться в качестве заместителя экономической свободы (Pattanaik and Nayak 2014; Santiago et al. 2018). Многие предыдущие исследования показывают, что экономическая свобода может способствовать экономическому развитию, поскольку рыночные реформы способствуют повышению уровня предпринимательской активности и созданию малого бизнеса. Это важно в контексте экономики стран АСЕАН, поскольку многие из этих стран переживают и развивают свою правовую инфраструктуру. В результате будет интересно изучить влияние верховенства закона на экономический рост.Кроме того, исследование также включает условия взаимодействия финансовых учреждений и финансовых рынков с верховенством закона, обозначенные как \ (({\ text {fi}} \ times {\ text {law}}) _ {it} \) и \ (({\ text {fi}} \ times {\ text {law}}) _ {it} \) соответственно. Это позволяет получить более подробную спецификацию и дает лучшие выводы, поскольку предыдущие эмпирические исследования предполагают, что финансовое развитие зависит от институционального развития экономики (La Porta et al. 1998), в то время как другие считают, что финансовое развитие может фактически способствовать институциональному развитию за счет поощрение прозрачности банковской системы (Dutta and Mukherjee 2018).

Наконец, в исследовании используются несколько контрольных переменных, которые использовались в предыдущих регрессиях роста. Контрольная переменная \ ({\ text {hc}} _ {it} \) представляет человеческий капитал и измеряется с использованием индекса человеческого капитала, предложенного Feenstra et al. (2015). Роль человеческого капитала в экономическом росте хорошо известна во многих теориях эндогенного роста (Romer 1990), а роль человеческого капитала может дополнять финансовое развитие, которое может способствовать инклюзивному росту (Oyinlola and Adedeji 2019).Однако существуют эмпирические проблемы с измерением человеческого капитала, поскольку разные переменные человеческого капитала могут давать разные результаты. В этом исследовании используется индекс человеческого капитала, который отражает многомерную роль человеческого капитала, поскольку он учитывает среднюю продолжительность обучения в школе и уровень отдачи от образования (Feenstra et al. 2015). Кроме того, контрольные переменные включают открытость для торговли, обозначаемую \ ({\ text {opn}} _ {it} \), которая измеряет отношение общего импорта и экспорта к ВВП и плотность населения, обозначаемую \ ({\ text {pop}} _ {it} \), который измеряет плотность населения на 1000 м 2 2 .Эти контрольные переменные используются в предыдущих эмпирических исследованиях, в которых изучается роль торговли и населения в экономическом росте (Anwar and Sun 2016; Darku and Yeboah 2018; Haini 2019). Включение этих контрольных переменных обеспечивает более глубокое понимание детерминант экономического роста в странах АСЕАН.

Сводная статистика используемых переменных представлена ​​в таблице 2. Можно заметить, что экономики АСЕАН различаются по своему развитию во времени и по выборке.Например, если сосредоточить внимание на переменных производственной функции, реальный ВВП на рабочую силу в регионе АСЕАН в среднем составляет 0,039 со стандартным отклонением 0,054, что указывает на различия в развитии экономики стран АСЕАН. Аналогичным образом, реальный запас капитала на рабочую силу также показывает аналогичные цифры со средним значением 0,151 и стандартным отклонением 0,199, что указывает на высокий уровень дисперсии. Ожидается, что реальный запас капитала на рабочую силу будет положительным и значимым для зависимой переменной в соответствии с теорией производства.

Сосредоточившись на переменных финансового развития, индекс финансовых институтов имеет среднее значение 0,399 со стандартным отклонением 0,180, что предполагает более низкие уровни дисперсии по сравнению с переменными производственной функции. Как и ожидалось, средний индекс финансовых рынков ниже, чем индекс финансовых институтов, на 0,296, а также демонстрирует более высокий уровень дисперсии со стандартным отклонением 0,245. Финансовые учреждения, такие как банки, обычно доминируют в развивающихся странах, и поэтому неудивительно, что финансовые учреждения более развиты (Rajan, 1992).Однако максимальное значение индексов финансовых институтов и финансовых рынков варьируется. Можно заметить, что максимальное значение индекса финансовых рынков составляет 0,903, в то время как индекс финансовых институтов составляет 0,760. Это еще раз подчеркивает разнообразие экономик АСЕАН, где государства-члены, такие как Сингапур, имеют развитую финансовую систему со зрелыми рынками и институтами.

Между тем, с упором на институциональное развитие, среднее значение индекса верховенства закона составляет — 0.244 с большим стандартным отклонением 0,888. Эта разница отражает стремление экономик АСЕАН к реформированию на протяжении всего периода выборки, особенно после начала азиатского финансового кризиса в 1997 году, когда регион начал сосредотачивать свои усилия на институциональной региональной интеграции (Nicolas 2008). Наконец, регулирующая переменная открытости для торговли имеет среднее значение 1,118, что является ожидаемым, поскольку многие страны АСЕАН приняли экспортно-ориентированную стратегию (Lee and Tan 2006). Плотность населения демонстрирует высокий уровень вариации по региону, поскольку многие из этих экономик продолжают индустриализацию и урбанизацию, что приводит к агломерации (Nguyen 2018), в то время как индекс человеческого капитала демонстрирует меньшие вариации по выборке.

Наконец, перед оценкой модели системы GMM, все переменные преобразуются в логарифм и усредняются за 3-летние периоды. Использование средних значений сосредоточено на долгосрочной взаимосвязи, поскольку для реализации эффектов финансового развития может потребоваться время за счет возврата инвестиций с течением времени (Levine et al. 2000). В результате использование средних значений снижает влияние краткосрочных потрясений и экономических циклов. Что еще более важно, это оправдывает использование динамической панельной оценки, поскольку усреднение периодов времени уменьшает количество t по сравнению с размером выборки n .Это уменьшает количество инструментальных переменных и позволяет избежать чрезмерной идентификации инструментов. Наконец, семь наборов регрессий оцениваются для системной модели GMM, чтобы оценить чувствительность оценок, которые должны быть в целом одинаковыми для всех наборов регрессий. Набор (1) включает индекс финансового учреждения (fi) вместе с контрольными переменными, а набор (2) включает fi и его квадратный член fi 2 . Между тем, набор (3) включает индекс финансовых рынков (fm) вместе с контрольными переменными, а набор (4) включает fm и его квадратный член fm 2 .Набор (5) и (6) сосредоточен на условиях взаимодействия fm и fi с индексом верховенства закона (закон), а набор (7) включает как индексы финансового развития, так и его квадраты и условия взаимодействия.

Эконометрика: теория важна — назад к основам: финансы и развитие

Финансы и развитие

Сэм Улиарис

Если экономическая теория должна быть полезным инструментом для разработки политики, она должна поддаваться количественной оценке

Ракетка для номеров (фото: Tom Grill / Corbis)

Экономисты разрабатывают экономические модели для объяснения постоянно повторяющихся отношений.Их модели связывают одну или несколько экономических переменных с другими экономическими переменными. Например, экономисты связывают сумму, которую люди тратят на потребительские товары, с располагаемым доходом и богатством и ожидают, что потребление будет расти по мере увеличения располагаемого дохода и благосостояния (то есть связь положительная).

Часто существуют конкурирующие модели, способные объяснить одну и ту же повторяющуюся взаимосвязь, называемую эмпирической закономерностью, но лишь немногие модели дают полезные ключи к разгадке величины этой связи.Но это самое главное для политиков. Например, при определении денежно-кредитной политики руководителям центральных банков необходимо знать вероятное влияние изменений официальных процентных ставок на инфляцию и темпы роста экономики. Именно в таких случаях экономисты обращаются к эконометрике.

Эконометрика использует экономическую теорию, математику и статистические выводы для количественной оценки экономических явлений. Другими словами, он превращает теоретические экономические модели в полезные инструменты для разработки экономической политики.Цель эконометрики — преобразовать качественные утверждения (например, «взаимосвязь между двумя или более переменными положительна») в количественные утверждения (например, «потребительские расходы увеличиваются на 95 центов на каждый доллар увеличения располагаемого дохода»). Специалисты по эконометрике — специалисты по эконометрике — преобразуют модели, разработанные экономическими теоретиками, в версии, которые можно оценить. Как отмечают Сток и Уотсон (2007), «эконометрические методы используются во многих отраслях экономики, включая финансы, экономику труда, макроэкономику, микроэкономику и экономическую политику.«Решения в области экономической политики редко принимаются без эконометрического анализа для оценки их воздействия.

Непростая задача

Определенные особенности экономических данных затрудняют для экономистов количественную оценку экономических моделей. В отличие от исследователей в области физических наук, эконометристы редко могут проводить контролируемые эксперименты, в которых изменяется только одна переменная и измеряется реакция субъекта на это изменение. Вместо этого эконометристы оценивают экономические отношения, используя данные, полученные с помощью сложной системы связанных уравнений, в которой все переменные могут изменяться одновременно.Это поднимает вопрос о том, достаточно ли информации в данных, чтобы идентифицировать неизвестные в модели.

Эконометрику можно разделить на теоретическую и прикладную компоненты.

Теоретики-эконометристы исследуют свойства существующих статистических тестов и процедур для оценки неизвестных в модели. Они также стремятся разработать новые статистические процедуры, которые являются достоверными (или надежными), несмотря на особенности экономических данных, такие как их тенденция к одновременному изменению.Теоретическая эконометрика в значительной степени опирается на математику, теоретическую статистику и численные методы, чтобы доказать, что новые процедуры способны делать правильные выводы.

Прикладные эконометристы, напротив, используют эконометрические методы, разработанные теоретиками, для перевода качественных экономических заявлений в количественные. Поскольку специалисты по прикладной эконометрике ближе к данным, они часто сталкиваются — и предупреждают своих теоретиков — об атрибутах данных, которые приводят к проблемам с существующими методами оценки.Например, эконометрист может обнаружить, что дисперсия данных (насколько отдельные значения в серии отличаются от общего среднего) со временем меняется.

Основным инструментом эконометрики является модель линейной множественной регрессии, которая обеспечивает формальный подход к оценке того, как изменение одной экономической переменной, объясняющей переменной, влияет на объясняемую переменную, зависимую переменную, с учетом воздействия всех факторов. другие детерминанты зависимой переменной.Эта квалификация важна, потому что регрессия стремится оценить предельное влияние конкретной объясняющей переменной после учета влияния других объясняющих переменных в модели. Например, модель может попытаться изолировать эффект увеличения налогов на 1 процентный пункт на средние потребительские расходы домохозяйства, сохраняя неизменными другие детерминанты потребления, такие как доход до налогообложения, богатство и процентные ставки.

Этапы развития

Методология эконометрики довольно проста.

Первый шаг — предложить теорию или гипотезу для объяснения исследуемых данных. Объясняющие переменные в модели указаны, и четко указаны знак и / или величина взаимосвязи между каждой независимой переменной и зависимой переменной. На этом этапе анализа специалисты по прикладной эконометрике в значительной степени полагаются на экономическую теорию для формулирования гипотезы. Например, принцип международной экономики состоит в том, что цены через открытые границы движутся вместе после учета номинальных колебаний обменного курса (паритета покупательной способности).Эмпирическая взаимосвязь между внутренними ценами и иностранными ценами (с поправкой на изменение номинального обменного курса) должна быть положительной, и они должны изменяться вместе примерно один к одному.

Второй шаг — это спецификация статистической модели, которая отражает суть теории, которую проверяет экономист. Модель предлагает конкретную математическую связь между зависимой переменной и объясняющими переменными, о которой, к сожалению, экономическая теория обычно умалчивает.Безусловно, наиболее распространенным подходом является допущение линейности, то есть любое изменение независимой переменной всегда будет приводить к одинаковому изменению в зависимой переменной (то есть прямолинейной зависимости).

Поскольку невозможно учесть каждое влияние на зависимую переменную, в статистическую модель добавляется общая переменная, чтобы завершить ее спецификацию. Роль сводной информации состоит в том, чтобы представить все детерминанты зависимой переменной, которые невозможно учесть — либо из-за сложности данных, либо из-за их отсутствия.Экономисты обычно предполагают, что этот термин «ошибка» в среднем равен нулю и является непредсказуемым, просто чтобы соответствовать посылке о том, что статистическая модель учитывает все важные объясняющие переменные.

Третий шаг включает использование соответствующей статистической процедуры и эконометрического программного обеспечения для оценки неизвестных параметров (коэффициентов) модели с использованием экономических данных. Часто это самая простая часть анализа благодаря легкодоступным экономическим данным и отличному эконометрическому программному обеспечению.Тем не менее, знаменитый принцип вычислений GIGO (мусор на входе, мусор на выходе) применим и к эконометрике. То, что что-то можно вычислить, не означает, что это имеет экономический смысл.

Четвертый шаг, безусловно, самый важный: проведение теста на запах. Имеет ли оценочная модель экономический смысл, то есть дает ли она значимые экономические прогнозы? Например, соответствуют ли знаки оцененных параметров, которые связывают зависимую переменную с независимыми переменными, предсказаниям лежащей в основе экономической теории? (Например, в случае потребления домашних хозяйств валидность статистической модели была бы под вопросом, если бы она предсказывала снижение потребительских расходов при увеличении дохода).Если оцениваемые параметры не имеют смысла, как специалисту по эконометрике изменить статистическую модель, чтобы получить разумные оценки? И дает ли более разумная оценка экономически значимый эффект? Этот шаг, в частности, требует и проверяет навыки и опыт прикладного эконометриста.

Проверка гипотезы

Основным инструментом четвертого этапа является проверка гипотез, формальная статистическая процедура, в ходе которой исследователь делает конкретное заявление об истинном значении экономического параметра, а статистический тест определяет, соответствует ли оцениваемый параметр этой гипотезе.Если это не так, исследователь должен либо отвергнуть гипотезу, либо внести новые спецификации в статистическую модель и начать заново.

Если все четыре этапа проходят успешно, результатом является инструмент, который можно использовать для оценки эмпирической достоверности абстрактной экономической модели. Эмпирическая модель также может быть использована для построения способа прогнозирования зависимой переменной, потенциально помогая директивным органам принимать решения об изменениях в денежно-кредитной и / или налогово-бюджетной политике, чтобы экономика оставалась на плаву.

Студенты, изучающие эконометрику, часто восхищаются возможностью линейной множественной регрессии для оценки экономических отношений. Стоит помнить о трех основных принципах эконометрики.

• Во-первых, качество оценок параметров зависит от достоверности лежащей в основе экономической модели.

• Во-вторых, если соответствующая независимая переменная исключена, наиболее вероятным результатом будут плохие оценки параметров.

• В-третьих, даже если эконометрист идентифицирует процесс, который фактически сгенерировал данные, оценки параметров имеют лишь небольшой шанс быть равными фактическим значениям параметров, которые сгенерировали данные.Тем не менее, оценки будут использоваться, потому что со статистической точки зрения они станут точными по мере поступления большего количества данных.

Эконометрика, по своей природе, может давать в среднем правильные прогнозы, но только с помощью разумной экономики, определяющей спецификацию эмпирической модели. Несмотря на то, что это наука с четко установленными правилами и процедурами для подгонки моделей к экономическим данным, на практике эконометрика — это искусство, требующее серьезного суждения для получения оценок, полезных для разработки политики.

Сэм Улиарис — старший экономист Института МВФ.

Номер ссылки

Сток, Джеймс Х. и Марк У. Уотсон, 2007, Введение в эконометрику , Серия Аддисона-Уэсли по экономике (Бостон: Пирсон Аддисон Уэсли, 2-е изд.).

Данные МВФ

Базы данных «Перспективы развития мировой экономики» (WEO)

Обновлено Загрузите данные временных рядов для роста ВВП, инфляции, безработицы, платежных балансов, экспорта, импорта, внешнего долга, потоков капитала, цен на сырьевые товары.

Подробнее

Международная финансовая статистика (IFS)

Загрузите данные временных рядов для роста ВВП, инфляции, безработицы, платежных балансов, экспорта, импорта, внешнего долга, потоков капитала, цен на сырьевые товары.

Подробнее

Статистические данные МВФ

Обеспечивает полный доступ к IFS, BOPS, DOTS, GFS и бесплатный доступ к ряду дополнительных наборов данных МВФ.

Портал данных

Основные глобальные индикаторы (PGI)

Веб-сайт, на котором собраны данные по основным экономикам, доступные от международных агентств, охватывающих финансовый, государственный, внешний и реальный секторы, а также приведены ссылки на данные на веб-сайтах международных и национальных агентств.

Подробнее

Global Housing Watch

Веб-сайт, который отслеживает изменения на рынках жилья по всему миру.Он предоставляет текущие данные о ценах на жилье, а также показатели, используемые для оценки стоимости на рынках жилья, такие как соотношение цены на жилье к арендной плате и отношения цены на жилье к доходу.

Подробнее

Статистика платежного баланса (BOPS)

Ежегодник BOPS включает годовые агрегированные и подробные временные ряды платежного баланса и международной инвестиционной позиции стран; предоставляет мировые и региональные таблицы компонентов и агрегатов платежного баланса; и описания методологий, практики составления и источников данных, используемых отдельными странами.

Подробнее

Таксономия мер управления потоками капитала Новый

Таксономия мер управления потоками капитала (Таксономия) содержит информацию о мерах, оцененных персоналом Фонда как меры управления потоками капитала (CFM) и обсуждаемых в опубликованных отчетах персонала МВФ с момента принятия Институционального взгляда на либерализацию и управление потоками капитала. (IV) в ноябре 2012 г.

Загрузить PDF

Скачать Excel

Скоординированное исследование прямых инвестиций (CDIS) Новый

CDIS собирает данные и метаданные по позициям входящих и исходящих прямых инвестиций с перекрестной классификацией по странам-партнерам. Приведены отдельные данные по позициям капитала и долга, а также другие данные в разбивке.

Подробнее

Скоординированное обследование портфельных инвестиций (CPIS) Новый

CPIS собирает информацию о количестве трансграничных акций, а также долгосрочных и краткосрочных долговых ценных бумаг с разбивкой по стране проживания эмитента.

Подробнее

Валютная структура официальных валютных резервов (COFER)

Обновлено Агрегированные квартальные данные о валютной структуре официальных валютных резервов на конец периода.

Подробнее

Валютная структура официальных активов в иностранной валюте

МВФ провел специальное обследование стран-членов относительно их валютных резервов в официальных активах в иностранной валюте. Специальное обследование проводилось в апреле-мае 2015 г. и запрашивало данные о конечных позициях за 2013–2014 гг.Щелкните здесь , чтобы просмотреть сводные результаты этого опроса.

Шаблон данных о международных резервах и ликвидности в иностранной валюте

Повторно распространяет данные стран-членов МВФ о международных резервах и ликвидности в иностранной валюте в едином шаблоне и в единой валюте (долларах США). Также доступны исторические данные по странам и избранным темам.

Подробнее

Управление торговой статистики (DOTS)

Предоставляет данные о распределении экспорта и импорта стран по странам и регионам их партнерами.

Подробнее

Статистика государственных финансов (GFS)

Содержит подробные годовые статистические данные о доходах, расходах, операциях с активами и обязательствами, а также о запасах активов и пассивов сектора государственного управления и его подсекторов, представленных странами-членами.

Подробнее

Обзор финансового доступа (FAS)

Предоставляет годовые географические и демографические данные о доступе к основным потребительским финансовым услугам во всем мире. Это достигается за счет выявления и разработки соответствующих высококачественных данных, сопоставимых по странам и с течением времени, собираемых посредством периодических обследований.

Подробнее

Показатели финансовой устойчивости (ИФУ)

Предоставляет данные и подробные метаданные, регулярно представляемые первой партией стран-членов для 12 основных и 28 рекомендуемых ИФУ. Страны могут предоставлять ежемесячные, ежеквартальные, полугодовые или годовые отчеты о финансовых результатах для распространения.МВФ со временем будет стремиться расширить список стран-членов, представляющих отчеты.

Подробнее

Заметки о наблюдении G-20

Записки предоставлены персоналом МВФ перед серией встреч, проведенных депутатами и министрами «Большой двадцатки». Они представляют собой краткое изложение глобальных экономических перспектив на момент соответствующей встречи.

Подробнее

Объединенный центр внешней задолженности

База данных, которая объединяет данные о внешнем долге и отдельных иностранных активах, полученные от международных агентств (кредиторы / рыночные источники), и данные о внешнем долге, доступные из базы данных QEDS (национальные / дебиторские источники).

Подробнее

База данных обзора макропруденциальной политики Новый

Предоставляет информацию о пруденциальных мерах, принятых для сдерживания системных рисков, и институциональных механизмах, поддерживающих макропруденциальную политику в странах-членах.

Подробнее

Мониторинг базы данных по механизмам финансирования (MONA)

Загрузите сопоставимые данные об экономических целях и результатах поддерживаемых Фондом соглашений с 2002 года.

Подробнее

Цены на первичные сырьевые товары

Индексы в долларах или SDR, индексы рыночных цен на нетопливные товары и нефть, фактические рыночные цены на нетопливные товары и нефть, а также средние недельные цены на нетопливные товары и нефть.

Подробнее

Централизованная база данных статистики долга государственного сектора

Совместная база данных Всемирного банка и МВФ, которая ежеквартально представляет статистику долга государственного сектора (сектора государственного управления и государственных корпораций). Предоставляется разбивка по уровням государственного управления, типу инструментов, валюте и срокам погашения с использованием стандартных определений для поддержки межстрановых сравнений.

Подробнее

Квартальная статистика внешнего долга (QEDS)

Данные о внешнем долге, представленные подписчиками ССРД (распространенные на ряд экономик ОСРД в начале 2008 г.), с дополнительной информацией о валютной структуре, профиле обслуживания долга и других презентациях, которые облегчают анализ данных по странам.

Подробнее

Финансовые данные МВФ по странам

Краткое изложение отношений членов МВФ с Фондом

Подробнее

Финансовые данные МВФ по темам

Финансовая деятельность МВФ

Еженедельный сводный отчет о финансовой помощи странам-членам.

Подробнее

Финансовые ресурсы и ликвидность МВФ

(Ежемесячно) Общие ресурсы МВФ, полезные ресурсы и потенциал перспективных обязательств на один год (FCC).

Подробнее

Финансовые операции МВФ (ежеквартально)

Использование квотных ресурсов Фонда для финансирования операций.

Подробнее

Финансовая отчетность МВФ (квартальная)

Подготовлено в соответствии с Международными стандартами финансовой отчетности.

Подробнее

Годовой отчет

Финансовый год, заканчивающийся 30 апреля.

Подробнее

Корректировки процентной ставки по СДР, ставки вознаграждения, ставки сбора и распределения бремени

Обновлено обновляется каждый понедельник

Подробнее

Расчет процентной ставки по СДР

Процентная ставка по СДР определяется как сумма мультипликативных продуктов в СДР сумм валют в оценочной корзине СДР, уровня процентной ставки по финансовому инструменту для каждой составляющей валюты в корзине и обменного курса. каждой валюты по отношению к СПЗ.

Подробнее

Оценка SDR

Стоимость СДР в валюте рассчитывается ежедневно, а оценочная корзина пересматривается и корректируется каждые пять лет.

Подробнее

Новая корзина SDR

Первоначальные веса, присвоенные каждой валюте в корзине СДР, были скорректированы с учетом изменений доли каждой валюты в мировом экспорте товаров и услуг и международных резервов.

Подробнее

Политические комитеты и рабочие группы

Организованные семью основными политическими комитетами и состоящие из экспертов, назначенных федерациями-членами, рабочие группы обсуждают предложенное законодательство ЕС и приходят к единому мнению о влиянии этих предложений на предприятия. Мнения публикуются как официальные документы с изложением позиции BusinessEurope (около 100 ежегодно), и задача постоянного персонала — обеспечить их учет при принятии законодательных решений.

Комитет по экономическим и финансовым вопросам
Комитет по предпринимательству и МСП
Комитет по промышленным вопросам
Комитет по внутреннему рынку
Комитет по международным отношениям
Комитет по правовым вопросам
Комитет по социальным вопросам


Комитет по экономическим и финансовым вопросам

Стул
Г-н Клаус Гюнтер Дойч

Заместители председателя
Г-н Иниго Фернандес де Меса
Г-н Педро Капучо

Комитет по экономическим и финансовым вопросам опирается на работу своих рабочих групп по разработке политики BusinessEurope в ключевых областях макроэкономики, экономического управления, структурных реформ, налогообложения и финансового регулирования.В частности, комитет занимался разработкой дважды в год экономического прогноза BusinessEurope, рассматривая перспективы экономики ЕС и нашего ежегодного Барометра реформ.

Рабочие группы
Стулья
Сотрудник
Налоговая политика Г-н Кристер Андерссон Джеймс Уотсон
Питер Берт
+32.2.237.65.15
+32.2.237.65.21
Рабочая группа по налоговой политике отслеживает вопросы корпоративной налоговой политики на европейском уровне и представляет наших членов в налоговых группах ЕС, таких как Платформа для надлежащего налогового управления
В А Т Г-н Кристиан Коктведгаард Питер Берт +32.2.237.65.21
Рабочая группа по НДС занимается всеми вопросами, связанными с налогом на добавленную стоимость (НДС) на европейском уровне, и представляет наших членов на форуме ЕС по НДС.
Зеленое налогообложение г-жа An Theeuwes Питер Берт +32.2.237.65.21
Рабочая группа по экологическому налогообложению занимается европейскими приоритетами в отношении налогов на выбросы CO2 и энергии, директивой по налогу на энергию и политикой экологического налогообложения во всем ЕС.
Региональная политика Г-н Кристиан Хельменштейн Джеймс Уотсон +32.2.237.65.15
Рабочая группа по региональной политике занимается в основном политикой ЕС, касающейся использования фондов ЕС для экономического развития в государствах-членах.
Финансовые вопросы Эрик Берггрен +32.2.237.65.55
Рабочая группа по финансовым вопросам стремится обеспечить доступ к финансам на разумных условиях для компаний, чтобы они могли делать инвестиции, необходимые для стимулирования роста и поддержания конкурентоспособности. Он способствует должным образом сбалансированным соображениям стабильности и роста, чтобы финансовое регулирование не становилось ненужным ограничением для экономики ЕС

Комитет по предпринимательству и МСП

Стул
Госпожа Анна-Лена Бом

Заместители председателя
Г-н Диего Мингарелли
Г-н Ларс Холм Нильсен

Комитет занимается улучшением операционных условий, влияющих на создание и развитие МСП: объем и качество регулирования, доступ к финансам, доступ к рынкам ЕС и стран, не входящих в ЕС, и т. Д.Он также способствует развитию горизонтальной политики ЕС в отношении МСП, направленной на раскрытие потенциала МСП для роста и создания рабочих мест.

Сотрудник
Даниэле Оливьери, +32.2.237.65.48


Комитет по промышленным вопросам

Стул
Mr Holger Lösch

Заместители председателя
Г-жа Лина Хокансдоттер
Д-р Зузана Крейцирикова

Комитет по промышленным вопросам BusinessEurope занимается вопросами конкурентоспособности и роста промышленности.Он наблюдает за работой рабочих групп и целевых групп в области энергетики, окружающей среды и инноваций.

Рабочие группы
Стулья
Сотрудник
Энергия и климат

Сесилия Серрано-Пьедекасас
Каролина Виго

+32.2.237.65.97
+32.2.237.65.45
Рабочая группа по энергетике и климату занимается, среди прочего, Энергетическим союзом — безопасностью поставок, энергоэффективностью, ценами и затратами на энергию, дизайном рынка электроэнергии — сланцевым газом, схемой торговли выбросами ЕС и международными переговорами по климату.
Исследования и инновации

Д-р Норберт Лютке-Энтруп

Каролина Виго +32.2.237.65.45
Рабочая группа по исследованиям и инновациям в основном занимается исследовательской и инновационной политикой в ​​целом, включая управление инновациями и более совершенную нормативно-правовую базу для инноваций, принцип инноваций, систему разработки научно-обоснованной политики, а также программы исследовательских рамок, в частности Горизонт Европы.
Окружающая среда Г-н Нил Уокер Сесилия Серрано-Пьедекасас +32.2.237.65.97
Рабочая группа по окружающей среде занимается, среди прочего, пакетом замкнутой экономики, качеством воздуха, промышленными выбросами, REACH, а также законодательством в области биоразнообразия и природы.
Мобильность с низким уровнем выбросов Г-н Фриц де Гроот Александр Аффре +32.2.235.67,39

Целевая группа по мобильности с низким уровнем выбросов объединяет ключевых экспертов из Рабочей группы по транспорту и Рабочей группы по энергетике и климату для обсуждения будущего законодательства по этой теме, а также для проактивного предоставления директивным органам указаний по новым аспектам. Ключевая цель — помочь Европе перейти к здоровой, конкурентоспособной экономике, основанной на низкоуглеродных видах транспорта. В ближайшие годы будут сделаны огромные инвестиции в новые технологии, топливо и эффективность, и важно, чтобы значительная их доля приходилась на Европу.

Торговля и климат Жасмин Плонер (Торговля)
Александр Аффре (Климат)
+32.2.237.65.68
+32.2.237.65.39

Целевая группа по торговле и климату обсуждает связи между двумя областями политики и то, как они могут дополнять и усиливать друг друга. Целевая группа стремится внести конструктивный вклад в текущие дискуссии на европейском уровне, определив возможные меры политики.

Целевая группа по устойчивому финансированию Педро Оливейра / Александр Аффре Каролина Виго +32.2.237.65.45

Целевая группа по устойчивому финансированию обсуждает связи между таксономией устойчивого финансирования, нефинансовой отчетностью, корпоративным управлением, инструментами финансирования ЕС и смежными темами в контексте инвестиционного плана «Устойчивая Европа / Зеленая сделка». Целевая группа призвана координировать и вносить вклад в текущие обсуждения обновленной европейской стратегии устойчивого финансирования.


Комитет внутреннего рынка

Стул
Г-н Маттео Борсани

Заместители председателя
Г-жа Яна Хартман Радова

Комитет по внутреннему рынку отвечает за определение общих приоритетов BusinessEurope по вопросам единого рынка и координирует деятельность соответствующих рабочих групп. Он также занимается сквозными проблемами, которые являются общими для различных областей единого рынка.

Рабочие группы
Стулья
Сотрудник
Свободное перемещение товаров Г-н Пол Коберг ван ден Браак Мартинас Борисас +32.2.237.65.72
Рабочая группа по свободному перемещению товаров занимается устранением существующих препятствий для товаров на едином рынке.Это включает обеспечение эффективной европейской системы стандартизации; содействие применению взаимного признания; и поддержка надзора за рынком для поддержания равных условий игры.
Государственные контракты Г-жа Арнхильд Дорди Гьённес Катерина Фортуна +32.2.237.65.36
Рабочая группа по государственным контрактам занимается в основном обеспечением прозрачных и конкурентных процессов тендеров, чтобы обеспечить максимальную экономическую ценность для налогоплательщиков.Группа также работает в сфере услуг, представляющих общеэкономический интерес, и в сфере государственно-частного партнерства.
Свободное перемещение услуг Г-жа Семилле Устюн Мартинас Борисас +32.2.237.65.72
Рабочая группа по свободному перемещению услуг занимается устранением существующих и предотвращением новых препятствий на пути к свободе предоставления услуг в ЕС. В нем рассматриваются нормативные и административные барьеры и вопросы реализации ключевых законодательных актов ЕС в этой области политики, таких как директивы по услугам (2006/123 / EC), по профессиональной квалификации (2005/36 / EC) или по тесту соразмерности. до принятия нового регламента профессий (ЕС 2018/95).
Транспорт Г-н Майкл Сване Катерина Фортуна +32.2.237.65.36
Транспортная рабочая группа рассматривает препятствия на пути создания эффективного единого рынка для транспортного сектора с широкой точки зрения, объединяя взгляды как транспортных операторов, так и отрасли как пользователя транспортных услуг в целом. Он определяет позиции BusinessEurope в отношении нормативно-правовой базы для предоставления трансграничных транспортных услуг, оцифровки транспортных решений, финансирования инфраструктуры и взаимодействия, а также устанавливает связи с работой Целевой группы по мобильности с низким уровнем выбросов
Лучшее регулирование Г-н Кристоф Бауш Мартинас Борисас

+32.2.237.65.72

Рабочая группа по лучшему регулированию стремится обеспечить использование более совершенных инструментов регулирования, таких как оценка воздействия, эффективное участие заинтересованных сторон и комплексные программы снижения бремени, всеми лицами, принимающими решения, для сокращения бюрократизма и разработки пропорционального законодательства.
Целевая группа по цифровой экономике Д-р Курт-Кристиан Шил Патрик Грант +32.2.237.65.46
Целевая группа по цифровой экономике охватывает ряд тем, в том числе: экономику данных, закон о конфиденциальности, кибербезопасность, искусственный интеллект и платформенную экономику.

Комитет по международным отношениям


Стул
Mr Pat Ivory

Заместители председателя
Г-н Лоран Шеер
Г-н Джордж Ксирогианнис

Комитет определяет общие цели политики по международным вопросам, уделяя особое внимание торговым и инвестиционным приоритетам.

Рабочие группы
Стулья
Сотрудник
ВТО София Бурну
Морис Фермон
+32.2.237.65.29
+32.2.237.65.04
Рабочая группа продвигает либерализацию многосторонней торговли и готовит рекомендации по программе работы ВТО, охватывающей переговоры по многосторонним и плюрилатеральным соглашениям. Это также способствует принятию новых правил в области многосторонней торговли.
Двусторонние переговоры о свободной торговле Г-н Винанд Куэдвлиг Элеонора Кателла
Бенедикт Виденхофер
+32.2.237.65.65
+32.2.237.65.60
Рабочая группа предоставляет платформу для обсуждения приоритетов бизнеса ЕС в переговорах по двусторонним соглашениям о свободной торговле, проводимых Европейской комиссией, и в реализации уже действующих соглашений. Он также поддерживает контакты с бизнес-организациями в третьих странах.
Китайская сеть Г-н Флавио Бреган Морис Фермон
Бенедикт Виденхофер
+32.2.237.65.04
+32.2.237.65.60
Сеть фокусируется на двусторонних экономических отношениях между ЕС и Китаем. Важными предметными областями являются переговоры по всеобъемлющему соглашению об инвестициях и присоединение Китая к Соглашению о государственных закупках ВТО. Группа также уделяет внимание экономическим реформам Китая и готовит материалы для участия BusinessEurope в двусторонних диалогах на высоком уровне, таких как регулярный бизнес-саммит ЕС-Китай.
Сеть Индии Морис Фермон +32.2.237.65.04
Сеть фокусируется на двусторонних экономических отношениях между ЕС и Индией. Он служит платформой для обсуждения путей укрепления отношений и в основном охватывает текущие переговоры по соглашению о свободной торговле, способы улучшения инвестиционного и делового климата в Индии и основные препятствия для европейского бизнеса.
Сеть в Японии Г-н Эрик Бергелин Морис Фермон +32.2.237.65.04
Сеть фокусируется на двусторонних экономических отношениях между ЕС и Японией. Его основное внимание уделяется переговорам по соглашению о свободной торговле между ЕС и Японией. Он также служит платформой для обсуждения политики и подготавливает материалы для ежегодного делового круглого стола между ЕС и Японией и ежегодной межотраслевой встречи между BusinessEurope и ее японским коллегой Кейданреном.
США Мистер Пэт слоновая кость Элеонора Кателла +32.2,237,65,65
Сеть США стремится предоставить платформу для обсуждения того, как внести свой вклад в успешное завершение переговоров о трансатлантическом торговом и инвестиционном партнерстве, а также для обмена мнениями об отношениях между ЕС и США в целом. Он также поддерживает контакты с бизнес-организациями в Соединенных Штатах.
Средиземноморская сеть София Бурну +32.2.237.65.29
Сеть контролирует торгово-экономические отношения между ЕС и странами Средиземноморья.В частности, в нем рассматриваются евро-средиземноморские соглашения об ассоциации и продолжающиеся переговоры по соглашениям о свободной торговле между ЕС и Марокко, Тунисом, Египтом и Иорданией.
Сеть Меркосур Г-н Карлос Родригес Кочина Элеонора Кателла +32.2.237.65.65
Сеть отслеживает общие торгово-экономические отношения между ЕС и МЕРКОСУР, работая над способами продвижения интересов европейских инвесторов в странах МЕРКОСУР.Он также поддерживает контакты с бизнес-организациями в Бразилии.
Россия Г-н Петри Вуорио София Бурну +32.2.237.65.29
Сеть следит за торгово-экономическими отношениями между ЕС и Россией в целом, разрабатывая способы продвижения интересов европейских инвесторов в России. Он также поддерживает контакты с бизнес-организациями в России.
Таможня Г-н Леон Кантерс Морис Фермон +32.2.237.65.04
Группа охватывает большое количество областей таможенной политики и вносит существенный вклад в такие темы, как модернизация Таможенного кодекса Союза и таможенных разделов различных соглашений о свободной торговле. Наши эксперты участвуют в торговой контактной группе ЕС и вносят технический вклад в то, как модернизировать и упростить таможенные процессы ЕС для бизнеса.
Доступ на рынок г-н Рене ван Слотен София Бурну +32.2.237.65.29
Группа работает над способами расширения доступа европейских компаний на третьи рынки, особенно в рамках стратегии доступа на рынки ЕС. Его работа особенно сосредоточена в области государственных закупок, сырьевой политики и международной инвестиционной политики.
Инструменты торговой политики г-жа Инес Ван Лиерде Элеонора Кателла +32.2.237.65.65
Рабочая группа обсуждает способы обеспечения эффективности инструментов торговой политики ЕС в области торговой защиты (антидемпинговые, анти-субсидии и защитные меры).
Африка / Развитие Г-н Франсиско Мантеро Бенедикт Виденхофер +32.2.237.65.60
Рабочая группа фокусируется на роли, которую частный сектор может играть в разработке политики в целях развития. Он также следит за переговорами и выполнением соглашений об экономическом партнерстве, подписанных между ЕС, странами Африки, Карибского бассейна и Тихого океана.
Экспортный контроль товаров двойного назначения Г-н Сандро Зеро София Бурну +32.2.237.65.29
Рабочая группа в основном занимается вопросами экспортного контроля ЕС в отношении режима товаров двойного назначения и его реализацией.
Санкции София Бурну
Жасмин Плонер
+32.2.237.65.29
+32.2.237.65.68
Целевая группа по санкциям занимается реализацией ограничительных мер в отношении третьих стран, на которые распространяется режим санкций Европейского Союза, и их влиянием на бизнес ЕС.Кроме того, он направлен на обсуждение экстерриториального воздействия режимов санкций в отношении третьих сторон на европейскую коммерческую деятельность.
Торговля и климат Жасмин Ploner +32.2.237.65.68

Целевая группа по торговле и климату обсуждает связи между двумя областями политики и то, как они могут дополнять и усиливать друг друга. Целевая группа стремится внести конструктивный вклад в текущие дискуссии на европейском уровне, определив возможные меры политики.


Комитет по правовым вопросам

Стул
Mr Philippe Lambrecht

Заместители председателя
Г-н Антонио Матонти
Г-жа Жоэль Симон

Юридический комитет отвечает за определение общих приоритетов BusinessEurope по правовым вопросам и координацию деятельности рабочих групп, входящих в его компетенцию. Он также касается сквозных юридических досье, выходящих за рамки компетенции одной рабочей группы.

Рабочие группы
Стулья
Сотрудник
Конкуренция Г-н Йорн Айкхофф Эрик Берггрен +32.2.237.65.55
Рабочая группа по конкуренции отвечает за вопросы политики, связанные с обеспечением соблюдения антимонопольных правил ЕС — злоупотребление доминирующим положением, картели и слияния.Он фокусируется на горизонтальных инициативах, связанных с надлежащей правовой процедурой, действиями по возмещению ущерба, Европейской конкурентной сетью, правилами вертикальных и горизонтальных соглашений, среди прочего. Он вносит вклад в работу других групп по таким вопросам, как конкуренция в цифровой экономике и телекоммуникациях, а также занимается развитием международного законодательства о конкуренции.
Закон о компаниях Г-жа Жоэль Симон

Педро Оливейра

+32.2.237.65.56
Рабочая группа по корпоративному праву занимается вопросами, тесно связанными со всем жизненным циклом компаний. Это включает их создание (директивы о требованиях к формированию, формы европейских компаний), управление и отношения с заинтересованными сторонами (кодексы корпоративного управления, права акционеров и прозрачность) до их исчезновения (несостоятельность и реструктуризация). Это способствует мобильности компании на едином рынке и хорошему корпоративному управлению.
Государственная помощь Mr Morten Qvist Fog Эрик Берггрен +32.2,237,65,55
Рабочая группа по государственной помощи руководит деятельностью, связанной с установлением государственной помощи ЕС, как по процедурным, так и по существенным аспектам, для обеспечения равных условий игры на едином рынке и последовательного применения правил с соответствующими процедурами и правоприменением. Группа также рассматривает необходимость обеспечения разумного европейского подхода к субсидиям, который учитывает глобальную конкурентоспособность ЕС и позволяет достичь европейских целей, например, с точки зрения расходов на НИОКР, энергоэффективности и регионального развития.
Товарные знаки и образцы Д-р Мартина Эберле Елена Бертолотто +32.2.237.65.51
Рабочая группа по товарным знакам и образцам занимается европейской системой товарных знаков. Его приоритетом является внедрение новых рамок ЕС посредством работы с агентством ЕС, ответственным за торговую марку ЕС. Он также следует за работой Европейской обсерватории по нарушениям прав интеллектуальной собственности.
Гармонизация бухгалтерского учета
Звуковая панель
Г-н Клас Норберг Эрик Берггрен +32.2,237,65,55
Рабочая группа по гармонизации бухгалтерского учета и Звуковой совет стремятся обеспечить набор международных стандартов финансовой отчетности (МСФО), отвечающих потребностям европейских компаний. Он также способствует сближению стандартов бухгалтерского учета США с МСФО с целью достижения взаимного признания.
ПОЕЗДКИ Елена Бертолотто +32.2.237.65.51
Рабочая группа TRIPs занимается тем, как интеллектуальная собственность влияет на глобальные социальные проблемы (например,грамм. изменение климата, доступ к медицине, здравоохранению, электронным отходам, продуктам питания и санитарии). Он поддерживает глобальные минимальные стандарты интеллектуальной собственности через соглашение TRIPs и борется с экспроприацией интеллектуальной собственности.
Потребитель / маркетинг г-жа Мария Тереза ​​Лейн Педро Оливейра +32.2.237.65.56
Рабочая группа по потребителям / маркетингу занимается законодательством и политикой ЕС в области защиты потребителей (права потребителей, возмещение ущерба, альтернативное законодательство о спорах, правоприменение и информация), а также законодательством о маркетинге (коммерческая практика, торговая практика и реклама).Он способствует разумной и сбалансированной потребительской политике и активному диалогу с потребителями.
Патенты Г-н Тьерри Сюер Елена Бертолотто +32.2.237.65.51
Рабочая группа по патентам стремится улучшить общую патентную систему в Европе, сделав так, чтобы единый патент и единый патентный суд стали реальностью. Он также участвует в международной деятельности по патентному сотрудничеству между патентными ведомствами и предприятиями (например,грамм. Трехсторонняя / IP5), чтобы сократить расходы, сократить бюрократизм и повысить юридическую уверенность компаний во всем мире.
Авторские права Елена Бертолотто +32.2.237.65.51
Рабочая группа по авторскому праву занимается продолжающейся реформой авторского права ЕС. Он продвигает хорошо функционирующую и гибкую систему авторского права, чтобы облегчить цифровую эволюцию, включая эффективное правоприменение также в онлайн-среде. Он поддерживает сбалансированный подход между правами правообладателей и дальнейшим развитием и предоставлением инновационных услуг в цифровой экономике.

Комитет по социальным вопросам

Председатель
Г-н Гарри Кириазис

Заместители председателя
Г-жа Габриэлла Себардт
Г-н Роберт Лисицки

Комитет по социальным вопросам определяет стратегическое направление работы BusinessEurope в области занятости и социальных дел. Это орган, ответственный за принятие позиций, подготовленных рабочими группами в рамках его компетенции. Он следит за прогрессом, достигнутым в странах-членах ЕС в плане реализации реформ рынка труда.Он также разрабатывает действия и наблюдает за переговорами в контексте европейского социального диалога.

Рабочие группы
Стулья
Сотрудник
Производственные отношения Г-н Нильс К. Трампе +32.2.237.65 …
Рабочая группа по производственным отношениям обсуждает и готовит позиции по вопросам, связанным с законодательством ЕС об условиях труда (например,грамм. размещение рабочих, заемная работа, неполный рабочий день, срочная работа), а также информация и консультации рабочих (например, директива европейских рабочих советов). Члены также обмениваются информацией об изменениях в трудовом законодательстве и ведении коллективных переговоров на национальном уровне.
Социальная защита Г-н Марио Ван Мирло Анна Квяткевич-Мори +32.2.237.65.92
Рабочая группа по социальной защите обсуждает и готовит позиции по вопросам, связанным с пенсиями, и более широким темам, таким как реформы систем социальной защиты.Члены также обмениваются информацией о национальных изменениях в системах социальной защиты.
Занятость Г-н Мэтью Персиваль Анна Квяткевич-Мори +32.2.237.65.92
Рабочая группа по вопросам занятости обсуждает и готовит позиции по вопросам, связанным с общим подходом к политике занятости ЕС, включая занятость молодежи и активную политику на рынке труда.
Здоровье и безопасность на рабочем месте Г-н Крис Де Мистер +32.2,237,65 …
Рабочая группа по здоровью и безопасности обсуждает и готовит позиции по вопросам, связанным со здоровьем и безопасностью на рабочем месте, включая стратегии ЕС, законодательство ЕС и конкретные темы, такие как эргономика ЕС, подверженность работников химическим веществам и психосоциальные риски. Он также вносит свой вклад в кампании Европейского агентства по охране труда и здоровья на рабочих местах.
Образование и обучение г-жа Анн Вошес Роберт Пламмер +32.2,237,65,75
Рабочая группа по образованию и обучению обсуждает и готовит позиции по таким вопросам, как стратегии ЕС по развитию навыков, результаты обучения, стажировки, европейские рамки сотрудничества в области профессионального образования и обучения и высшего образования, а также инструменты ЕС в области образования и обучения.
Корпоративная социальная ответственность / социальные положения Г-жа Ренате Хорнунг-Драус Ребекка Смит +32.2.237.65.16
Рабочая группа по корпоративной социальной ответственности (КСО) / социальным положениям обсуждает и готовит позиции по вопросам, связанным с добровольным обязательством бизнеса учитывать социальное и экологическое воздействие своей деятельности, в консультации с заинтересованными сторонами таким образом, чтобы их конкурентоспособность. В нем обсуждаются стратегии ЕС в области КСО, законодательство о раскрытии нефинансовой информации, вопросы цепочки поставок и обмен информацией о методах и инструментах КСО.
Миграция и мобильность Г-н Луис Энрике Роберт Пламмер +32.2.237.65.75
Рабочая группа по миграции и мобильности обсуждает и готовит позиции по вопросам, связанным с миграцией из третьих стран, в частности, законодательства ЕС об экономической миграции (например, директивы о голубой карте), политики по интеграции беженцев / мигрантов на рынке труда, а также по этому вопросу. мобильности рабочих внутри ЕС.
Равные возможности Г-жа Минна Эту-Сеппяля +32.2,237,65 …
Сеть равных возможностей обсуждает и готовит позиции по таким вопросам, как разнообразие, недискриминация, гендерное равенство и совмещение работы и семейной жизни.

Экономические отношения США и Китая: последствия для политики США

С момента начала экономических реформ в конце 1970-х годов экономика Китая была одной из самых быстрорастущих в мире. Между 1979 и 2000 годами реальный валовой внутренний продукт (ВВП) увеличился более чем в шесть раз.Хотя доход на душу населения остается низким, огромная численность населения Китая означает, что в совокупности он уже входит в число крупнейших экономик мира, намного больше, чем, например, Россия или Индия, или даже две вместе взятые. В тот же период рост международной торговли Китая был еще более впечатляющим, так что доля страны в мировой торговле увеличилась более чем в пять раз, примерно до 4 процентов в настоящее время. Ни одна другая страна никогда не увеличивала свою долю в мировой торговле так быстро. С 1995 года Китай входит в десятку ведущих торговых стран мира.

Экономический подъем Китая

Перспективное членство Китая во Всемирной торговой организации (ВТО) имеет огромные потенциальные последствия как для Китая, так и для международной торговой системы. Приверженность руководства Китая дальнейшему открытию своих внутренних рынков для импорта, иностранных услуг и иностранных инвестиций будет означать усиление внутренней конкуренции, которую руководство рассчитывает использовать для ускорения внутренней экономической реструктуризации. Цель не столько в том, чтобы увеличить общие темпы роста, сколько в улучшении качества роста и обеспечении его устойчивости.Китай хочет уменьшить деградацию окружающей среды, увеличить долю потребления в национальном доходе, способствовать росту производительности и сократить отходы. Если эту стратегию удастся реализовать успешно, Китай продолжит сокращать все еще очень большой разрыв в уровне доходов на душу населения между собой и наиболее развитыми промышленными странами.

Если эти тенденции не изменятся коренным образом, ожидается, что экономика Китая превзойдет экономику всех отдельных европейских стран по размеру ВВП и будет уступать только США и Японии в течение двух десятилетий.За тот же период Китай может стать второй по величине торговой страной мира, уступив только США.

Последствия для мировой торговой системы

Вступление Китая в ВТО зависит от успешного завершения многостороннего этапа переговоров о вступлении, которые в настоящее время ведутся. Членство Китая будет иметь большое значение для будущего международной торговой системы по нескольким причинам. Во-первых, условия его приема послужат образцом для ряда других стран с переходной экономикой, которые стремятся стать членами ВТО, включая Россию.Учитывая чрезвычайно жесткие условия, которые китайцы приняли на двусторонней стадии переговоров о вступлении в ВТО, планка условий вступления для новых членов была установлена ​​очень высокой. Во-вторых, хотя Китай предпринял важные шаги по выполнению некоторых своих обязательств перед ВТО, скорость, с которой он может завершить этот процесс, может разочаровать некоторых членов организации. Учитывая большой объем его международной торговли, существует риск того, что торговые конфликты с участием Китая могут перегрузить возможности ВТО по разрешению споров.В-третьих, Китай, вероятно, будет играть важную роль в формировании повестки дня следующего раунда многосторонних торговых переговоров. Как первая развивающаяся страна, вошедшая в десятку ведущих торговых стран мира и член ВТО, Китай может стать решительным защитником в следующем раунде интересов развивающихся стран. Наконец, вступление Китая, вероятно, потребует значительных изменений в неформальных структурах управления ВТО. Китай критически относился к процедурам и практике, которые отводят необычную неформальную роль в определении повестки дня так называемым странам четверки, и утверждал, что интересы развивающихся стран недостаточно представлены в процессе принятия решений ВТО.Таким образом, он может искать корректировки в неформальных структурах управления организации.

Последствия для торгового дефицита США с Китаем

Вступление Китая в ВТО вряд ли сократит двусторонний торговый дефицит или устранит торговые трения с Соединенными Штатами по ряду причин. Во-первых, выгоды от вступления Китая могли быть переоценены администрацией, стремящейся к полномочиям на расширение постоянных нормальных торговых отношений (PNTR) с Китаем, чтобы избежать замораживания выгод от обязательств Китая в ВТО.Хотя двустороннее соглашение между Китаем и США, которое станет частью многосторонних обязательств Китая, действительно обеспечивает более широкое открытие рынков, рынки товаров Китая в среднем гораздо более открыты, чем это принято считать. Например, к началу 2001 года средняя тарифная ставка Китая была снижена до 15,3 процента, что примерно вдвое меньше уровня, преобладающего в Индии, и примерно эквивалентно тарифам в Бразилии и Мексике. Более того, 60 процентов всего импорта поступает в Китай в рамках одной из многих программ освобождения от импортных пошлин.В результате фактические сборы тарифов в Китае чрезвычайно скромны — менее 5 процентов от стоимости импорта.

Аналогичным образом, импортные квоты и лицензионные требования, которые раньше были повсеместными, неуклонно сокращались и к 2000 году покрывали только 4 процента всех импортных товаров. Таким образом, хотя более низкие тарифные и нетарифные барьеры, сопровождающие вступление Китая в ВТО, приведут к резкому увеличению экспорта из США нескольких продуктов, которые в настоящее время имеют высокую степень защиты, темпы расширения нашего экспорта в Китай в совокупности вряд ли увеличатся. резко ускориться.

Во-вторых, соглашение об условиях вступления Китая в ВТО не способствует сокращению общего торгового дефицита Соединенных Штатов, который определяется макроэкономическими факторами, такими как уровень национальных сбережений и инвестиций. До тех пор, пока норма сбережений не вырастет, уровень инвестиций не упадет или темпы роста экономики Соединенных Штатов не снизятся (как это было с середины 2000 года), общий торговый дефицит будет оставаться большим. В этих обстоятельствах неизбежно, что значительная часть инвестиций в этой стране будет финансироваться иностранным капиталом, в том числе китайским.Наш глобальный торговый дефицит — это просто зеркальное отражение этого большого притока капитала. Постоянно растущее использование валюты Соединенных Штатов во многих зарубежных странах также помогает финансировать торговый дефицит.

В-третьих, в соответствии с условиями соглашения о вступлении в ВТО Китай, как и другие производители текстиля и одежды из развивающихся стран, выиграет от поэтапного отказа и отмены в конце 2004 года квот, которые исторически ограничивали международную торговлю этими продуктами. Эти квоты искусственно ограничивают экспорт одежды из Китая в Соединенные Штаты с момента подписания первого двустороннего текстильного соглашения в сентябре 1980 года.Поскольку Китай является производителем с более низкими издержками, чем многие другие нынешние поставщики одежды в США, он почти наверняка вытеснит по крайней мере часть экспорта одежды из других стран по мере снятия ограничений. Хотя общий объем импорта одежды в Соединенные Штаты может незначительно увеличиться, доля китайского импорта почти наверняка увеличится. В результате общий объем импорта США из Китая будет и дальше расти по мере либерализации ограничений на торговлю текстилем и одеждой.

В-четвертых, Китай почти наверняка продолжит извлекать выгоду из переноса производств с других производственных площадок в Азии.В 1980-х и начале 1990-х годов промышленность была в основном сосредоточена на производстве игрушек, обуви и одежды. Начиная с начала 1990-х годов Тайвань начал переводить часть производственных мощностей по производству компьютерных компонентов в Китай, который быстро стал важным производителем материнских плат, мониторов и другого оборудования для ПК. В середине 1990-х Китай начал превращаться в важную производственную площадку для готовых компьютеров. К 2000 году две пятых всех тайваньских ПК были произведены в Китае. Перенос производственных мощностей из Тайваня на материк настолько продвинулся, что ожидается, что Китай заменит Тайвань в качестве третьего по величине производителя оборудования для информационных технологий в 2001 году.Китай также прилагает усилия для развития своей индустрии программного обеспечения, но в этой области он относительно менее развит, чем в производстве технологического оборудования.

Тенденции, описанные выше, почти наверняка будут ускоряться. Тайваньские компании готовы начать перевод своих ноутбуков и производства полупроводников в Китай. Хотя постановления правительства Тайваня сейчас запрещают эти инвестиции в Китай, эти правила почти наверняка будут изменены, как только Китай и Тайвань станут членами ВТО.Японские фирмы следуют аналогичной схеме, но с некоторым опозданием. На протяжении большей части 1990-х годов они сокращали свои инвестиции в Китай в результате общего сокращения зарубежных инвестиций и ощущения операционных трудностей в Китае. Но на рубеже тысячелетий японские инвестиции в Китай снова начали расти, поскольку фирмы переместили производство бытовой электроники и других товаров, особенно в южный Китай. Как и в случае с одеждой, Китай, вероятно, вытеснит альтернативные источники поставок, что приведет к увеличению U.С. импорт из Китая.

В результате действия этих факторов маловероятно, что дисбаланс в двусторонней торговле между Китаем и США уменьшится в ближайшее время. Любой политический подход к Китаю, направленный на сокращение дефицита за счет торговых ограничений или административного вмешательства, почти наверняка потерпит неудачу, по крайней мере, в краткосрочной перспективе. Хорошая новость заключается в том, что расширение двустороннего торгового дефицита с Китаем из-за эффекта вытеснения будет компенсировано сокращением дефицита в других странах мира и не будет способствовать увеличению глобального торгового дефицита Соединенных Штатов.Принимая во внимание, что двусторонний торговый дефицит необходимо будет контролировать, важно отметить, что Соединенные Штаты могут получить существенные неторговые выгоды от более широкого участия во внутреннем распределении и сфере услуг в Китае, которое станет возможным благодаря членству в ВТО.

Еще одна причина ожидать продолжения торговых трений заключается в том, что Китай не сможет полностью выполнить все свои обязательства перед ВТО в согласованные сроки. С положительной стороны, еще до завершения переговоров в ВТО Китай выполнил некоторые обязательства, взятые на себя в ходе двусторонних переговоров с США в 1999 году и с Европейским союзом в 2000 году.Например, правительство уже одобрило сделку, позволяющую AT&T приобрести 25-процентную долю в совместном предприятии по предоставлению широкополосных телекоммуникационных услуг в Пудуне, Шанхай, чего от компании не требовалось разрешать до тех пор, пока она не вступила в ВТО. Китай также снизил тарифы на товары, подпадающие под его обязательство участвовать в Соглашении ВТО по информационным технологиям. Некоторое снижение тарифов, произведенное в начале 2000 года, не потребовалось до 2004 или 2005 года. Китай также предпринял первые шаги для выполнения некоторых из своих обязательств по либерализации иностранного участия в аудиовизуальных услугах, строительстве, розничной торговле, юридических услугах и услугах распространения.Чтобы уравнять правила игры для отечественных и иностранных компаний, работающих в Китае, фискальные, финансовые и регулирующие органы начали процесс корректировки многих правил и систем, как того требуют правила ВТО.

Также положительным моментом является то, что законодательный орган Китая, Всекитайское собрание народных представителей, уже внес поправки в ряд важных внутренних законов, касающихся патентов, авторских прав, товарных знаков и иностранных инвестиций, чтобы привести их положения в соответствие с обязательствами ВТО. Хотя эти примеры не обязательно гарантируют, что Китай сможет выполнить все свои обязательства, они все же предполагают, что правительство прилагает очень существенные усилия для выполнения широкого круга своих обязательств и считает, что дальнейшая экономическая либерализация и открытость up необходимы для достижения собственных долгосрочных экономических целей.

Несмотря на эти усилия, было бы необычно, если бы Китай смог выполнить все свои обязательства перед ВТО во всех деталях и в срок. В рамках процесса переговоров о вступлении китайское правительство определило 177 внутренних законов и постановлений, касающихся таможенного администрирования, управления иностранными инвестициями, интеллектуальной собственностью и услугами, которые необходимо изменить, чтобы обеспечить соответствие обязательствам ВТО. Хотя начало положено, работа по пересмотру всех этих законов и их одобрению законодательным органом, вероятно, займет несколько лет.Еще больше времени уйдет на обучение судей и развитие правовых институтов и процессов, необходимых для обеспечения справедливого и беспристрастного соблюдения этих законов и исполнения судебных решений.
Более глубокая интеграция Китая в мировую экономику служит интересам США
Хотя торговые трения между США и Китаем не будут устранены, нет никаких сомнений в том, что углубляющаяся интеграция Китая в мировую экономику послужит ряду интересов США. Во-первых, это послужит нашим экономическим интересам.Приверженность Китая либерализации условий, на которых иностранные фирмы могут участвовать и инвестировать в телекоммуникации, внутреннее распределение, финансовые услуги, сектор развлечений и многие другие услуги, создает значительные возможности в тех областях, в которых американские фирмы, как правило, являются конкурентоспособными на международном уровне. В течение 1990-х годов Китай уже был самым быстрорастущим крупным иностранным рынком для экспорта товаров и услуг США. Либерализация торговли и инвестиций, которую Китай обязуется проводить в рамках ВТО, расширит наш доступ к этому рынку и повысит вероятность того, что экономические отношения останутся прочными.Расширение доступа к сельскохозяйственной продукции и автомобилям, вероятно, будет особенно важно для компаний США. Короче говоря, Китай может продолжать вносить свой вклад в рост нашей внешней торговли и нашего экономического благосостояния, связанного с торговлей. Поскольку Китай является эффективным производителем широкого спектра товаров, импорт из этой страны также может способствовать низкой инфляции цен в Соединенных Штатах.

Во-вторых, успешная интеграция в мировую экономику, вероятно, обеспечит конструктивное участие Китая в новом многостороннем раунде либерализации торговли.Руководство Китая признает фактические и потенциальные выгоды от усиления глобализации и даже зашло так далеко, что предложило создание зоны свободной торговли с Ассоциацией государств Юго-Восточной Азии (АСЕАН), в которую также войдут Япония и Южная Корея. Предложение такого рода со стороны Китая было немыслимо еще несколько лет назад. Если такой торговый блок в конечном итоге материализуется, вполне вероятно, что Тайвань станет его частью.

В-третьих, более глубокая интеграция и сопутствующее ускорение внутренних экономических реформ также увеличивают вероятность того, что Китай сможет оправдать ожидания своего населения, равного 1.3 миллиарда на повышение уровня жизни. Напротив, экономически обанкротившийся Китай приведет к региональной нестабильности и обернется значительными издержками для Соединенных Штатов и остального мира.

В-четвертых, последствия повышения уровня жизни в условиях все более рыночной экономики в подавляющем большинстве благоприятны для развития более плюралистической социальной и политической системы в Китае. Как и в случае с Тайванем, Южной Кореей и Таиландом, быстро модернизирующаяся экономика в какой-то момент, вероятно, вызовет эффективное давление в пользу политических изменений, уходящих от авторитарного правления.В случае с Тайванем прошло почти четыре десятилетия быстрого роста с момента введения в 1950 году всенародных выборов для окружных и городских властей и до отмены военного положения и легализации оппозиционных партий. Еще десять лет прошло до первых всенародных выборов президента. Хотя Китай уже более десяти лет проводит всенародные выборы на уровне деревень, вероятно, потребуется длительный период устойчивого экономического роста и стабильности, прежде чем начнет формироваться более плюралистическая политическая система.

Последствия для политики США

Учитывая наши долгосрочные торговые и инвестиционные интересы и связь между экономическими и политическими изменениями, которая была продемонстрирована в других странах Восточной Азии, каковы последствия для экономической политики США в отношении Китая? Во-первых, необходимо отказаться от политики, которая породила в Китае представление о том, что Соединенные Штаты стремятся отсрочить или даже заблокировать превращение Китая в крупную экономическую державу. Это означает, что новая администрация должна отказаться от санкций, введенных более десяти лет назад, которые остались в силе как наследие кризиса на площади Тяньаньмэнь в 1989 году.К ним относятся, среди прочего, требование о том, чтобы американский директор в Исполнительном совете Всемирного банка голосовал против или воздерживался от всех кредитов Китая, которые не предназначены строго для удовлетворения основных человеческих потребностей, а также выборочное удержание кредитов Экспортно-импортного банка и кредитных гарантий для неэкономические причины или причины, не связанные с безопасностью. В течение нескольких лет Соединенные Штаты были единственной страной в мире, которая все еще вводила такие санкции. Противодействие США кредитам Китая от Всемирного банка не блокирует такие ссуды, и в рамках программы отказа от требований некоторые ссуды от Экспортно-импортного банка были проданы.Поэтому эти санкции во многом символичны. Они посылают неверный сигнал о том, что Соединенные Штаты стремятся отсрочить или заблокировать превращение Китая в крупную экономическую державу.

Во-вторых, США не должны оставаться единственной развитой индустриальной страной, у которой нет систематической программы технической помощи, чтобы помочь китайскому правительству выполнить свои обязательства перед ВТО. Япония, Австралия, Канада и Европейский Союз, а также многие другие страны-члены предоставляют помощь, начиная от обучения государственных служащих и заканчивая предоставлением правовой помощи, связанной с ВТО.Хотя Фонд Форда финансировал некоторые связанные с ВТО программы юридической подготовки в Соединенных Штатах, правительство США никогда не финансировало программу верховенства закона, о которой с такой помпой объявил президент Клинтон в 1997 году во время его встречи на высшем уровне в Вашингтоне с Президент Цзян Цзэминь. Точно так же ряд ведомственных программ технического сотрудничества с Китаем по-прежнему недофинансируются. Отсутствие хорошо функционирующей государственной программы технической помощи по вопросам, связанным с ВТО, создает в Китае впечатление, что Соединенные Штаты больше заинтересованы в создании жестких условий, чем в содействии исторической трансформации Китая.

В-третьих, Соединенным Штатам следует быть очень разумными в применении жестких протекционистских принципов, на которые мы настаивали, чтобы Китай согласился в качестве условия членства в ВТО. Например, в соответствии с защитными мерами для конкретных продуктов, включенными в двустороннее соглашение от ноября 1999 г., Соединенные Штаты будут иметь возможность вводить односторонние ограничения на импорт из Китая на условиях, которые ни один другой член ВТО никогда не был обязан принимать. Более того, эти условия относительно легко выполнить, и основанные на них ограничения могут быть направлены исключительно против импорта из Китая.В соответствии с обычными защитными механизмами ВТО, если выполняются условия для их использования, ограничения должны быть пропорционально наложены на все страны-поставщики. Поскольку меры предосторожности для конкретных товаров противоречат основополагающему принципу ВТО о равном обращении со всеми странами, Соединенным Штатам следует применять этот инструмент против Китая только в исключительных обстоятельствах.

Точно так же Китай согласился подпадать под специальные защитные меры в отношении текстиля, которые позволяют Соединенным Штатам вводить односторонние ограничения на импорт китайских текстильных изделий и одежды в течение четырех лет после того, как нынешняя система квот будет отменена.В период 2005–2008 годов Китай будет единственным членом ВТО, на который могут быть распространены квотные ограничения на свои текстильные и швейные изделия.

Если Соединенные Штаты применит одну из этих двух мер защиты в условиях, которые, как считается, основаны на давлении со стороны отраслей, которые заявляют, что на них негативно влияет импорт из Китая, без явных доказательств причинения вреда их фирме, это, вероятно, подорвет поддержку ВТО в Китае и, возможно, среди других членов ВТО.Это, в свою очередь, осложнит, если не фактически прекратит, усилия Соединенных Штатов по запуску нового раунда многосторонних торговых переговоров.

Китай и Россия: экономическое неравенство

15 июля 2020

Си Цзиньпин и Владимир Путин пытаются поставить экономику в центр своего стратегического партнерства. «Экономическое сотрудничество и торговля как ключевая опора наших отношений имеют решающее значение для общего развития и возрождения Китая и России», — сказал Си во время визита в Москву в июне 2019 года. 1 «У нас беспрецедентно высокий уровень доверия и сотрудничества», — сказал Путин несколько месяцев спустя. «Это союзнические отношения в полном смысле многогранного стратегического партнерства. Это отражается на экономике ». 2

Фирменные экономические концепции Си и Путина даже на первый взгляд кажутся дополняющими друг друга. Инициатива Си Цзиньпина « Один пояс, один путь » (BRI) подтолкнула китайские компании к строительству автомобильных и железных дорог, оптоволоконных кабелей и другой жесткой инфраструктуры на евразийском суперконтиненте и за его пределами.Евразийский экономический союз Путина (ЕАЭС) гармонизирует таможенные процессы для создания единого рынка между Россией, Арменией, Беларусью, Казахстаном и Кыргызстаном. Мир, и особенно там, где эти усилия наиболее тесно пересекаются в Центральной Азии, нуждается как в «жесткой», так и «мягкой» модернизации инфраструктуры. Подыгрывая своим личным отношениям, Си и Путин неоднократно обещали «связать» BRI и ЕАЭС. Но они предоставили мало практических деталей, оставляя наблюдателям размышлять о будущем их экономических отношений.

В этом отчете рассматриваются четыре аспекта взаимодействия Китая и России и раскрывается растущее партнерство, которое сталкивается со структурными ограничениями. Торговля в основном сосредоточена на природных ресурсах, где интересы Китая и России наиболее сильно пересекаются. Инвестиции сдерживаются коррупцией и плохой инфраструктурой в России. Связи между людьми улучшаются, но недоверие остается, как показала пандемия Covid-19. Даже когда Китай и Россия сотрудничают в создании цифровой инфраструктуры, каждая сторона вводит ограничения, ограничивающие потоки данных.На пути к более глубоким связям стоят проблемы развития России и навязчивые идеи правительств обоих государств по сохранению контроля. 3

После оценки каждой из этих областей в последнем разделе рассматривается будущая траектория китайско-российских экономических отношений и ее последствия для интересов США. Возможности для роста есть, но по мере укрепления экономических связей Китая и России их партнерство станет еще более неравноправным. Юниорский статус России станет больше обузой, и российские официальные лица могут получить стимул к снижению риска большей зависимости от Китая.Огромная масса Китая, его близость и готовность экономически принуждать своих партнеров могут в конечном итоге вынудить Россию снова взглянуть на Запад, где остается большая часть ее торговли, несмотря на ее растущие связи с Китаем.

Торговля

Си и Путин рекламируют рост двусторонней торговли, показатель, который подчеркивает прогресс и партнерство, маскируя, как Россия стала более зависимой от Китая. В 2006 году Путин объявил о цели увеличения двусторонней торговли как минимум до 60 миллиардов долларов к 2010 году.С 2010 по 2015 год рост торговли замедлился, а затем восстановился.

Официальная цель была затем повышена до 100 миллиардов долларов, которую страны достигли в 2018 году. В прошлом году двусторонняя торговля почти достигла 110 миллиардов долларов, а Путин и Си объявили новую цель — 200 миллиардов долларов в торговле к 2024 году. Из этих цифр вырисовывается менее многообещающая для России картина. В 2010 году Китай обогнал Германию и стал крупнейшим торговым партнером России. Чтобы внести ясность, Европейский союз в целом остается крупнейшим партнером России, на долю которого в 2019 году пришлось 260 миллиардов долларов (232 миллиарда евро), что более чем вдвое превышает объем торговли Китая с Россией.Но в последние годы Китай стал более важным для России, на долю которого в 2018 году приходилось 15,5 процента ее общего товарооборота. Напротив, на Россию приходилось только 0,8 процента от общего объема торговли Китая в 2018 году. 5 Крупнейший экспорт России — энергоносители. стратегически важно, но по мере того, как торговые отношения становятся еще более однобокими, Китай приобретает большее влияние как покупатель, чем Россия как поставщик.

Си и Путин подчеркнули, что торговое сотрудничество расширяется по секторам, но за последние два десятилетия оно стало более сконцентрированным на сырье.«Торговая структура диверсифицируется. Конечно, на энергоносители приходится более 70 процентов нашего экспорта, но это естественно », — сказал Путин в прошлом году. 6 Далее он остановился на экспорте Россией ядерных энергетических систем, самолетов и даже систем предупреждения о ракетном нападении. Россия является крупнейшим поставщиком вооружений в Китай, обеспечивая 70 процентов импорта вооружений Китая в период с 2014 по 2018 год. 7 Эти примеры — ядерный, авиационный и оружейный экспорт — являются политически привлекательными, поскольку они изображают Россию как технологически развитую и усиливают впечатление о более глубоком сотрудничестве. по стратегическим вопросам.

Но реальность менее лестна для России. Россия экспортировала в Китай более широкий ассортимент товаров в 1990-е годы, когда Китай еще только развивался. Теперь их роли поменялись местами. 8 Как и в других областях с более высокой добавленной стоимостью, Китай становится все более конкурентоспособным в мировых продажах оружия и, обогнав Россию, стал вторым по величине производителем оружия в мире. 9 Российские фирмы обвинили Китай в незаконном копировании российской военной техники. 10 Им следует быть осторожными.Китайские фирмы, скорее всего, откажутся от своих российских партнеров, как они это сделали с другими иностранными фирмами, после того, как станут самодостаточными в производстве более сложного оборудования.

Торговая война между США и Китаем показала стремление России заменить экспорт сельскохозяйственной продукции США в Китай, но также высветила препятствия, с которыми она сталкивается. «В Китае [тарифы США] освобождаются ниши, и мы можем в нее вырасти», — заявил в прошлом году официальный представитель Дальнего Востока России Wall Street Journal . «Мы можем продавать все, что можем — спрос безграничен». 11 Но возможности России расти ограничены. Производство сои в России росло еще до торговой войны. Рост стоимости земли, плохая инфраструктура и бюрократическая волокита — все это препятствует увеличению производства. 12 Эти ограничения не будут устранены в одночасье, но чем хуже становятся торговые отношения между США и Китаем, тем больше у российских чиновников появляется стимул для их устранения.

Оборонительные интересы России ограничивают самые амбициозные предложения по более глубокой интеграции.Россия является двигателем ЕАЭС и заключила относительно скромные торговые соглашения с внешними партнерами для защиты своих более слабых отраслей. 13 Торговое соглашение между ЕАЭС и Китаем, вступившее в силу в прошлом году, не снижает тарифы. Российские официальные лица также сопротивлялись созданию зоны свободной торговли, охватывающей членов Шанхайской организации сотрудничества. Учитывая огромные размеры Китая, Россия, вероятно, и дальше будет избегать более глубоких соглашений о свободной торговле. Эта стратегия политически понятна, но экономически обречена на провал.Чем дольше Россия ждет, тем сложнее становится производство дорогостоящих товаров в Китае. В результате у России может оказаться, что ей все меньше и меньше нужно защищать.

Инвестиции

Неудовлетворительный опыт России в китайской программе BRI свидетельствует о давних препятствиях для инвестиций. Обе страны заинтересованы в улучшении инфраструктуры на евразийском суперконтиненте. Несмотря на общую границу в 2600 миль, у Китая и России всего несколько железнодорожных переездов и примерно 25 пунктов пропуска.Три из шести предложенных коридоров BRI проходят через ЕАЭС. Учитывая амбиции Китая и потребность России в улучшенной инфраструктуре, BRI должен быть естественным противодействием увеличению инвестиций.

Западные санкции также заставили Россию искать инвестиционные возможности в Китае. Проект «Ямал СПГ» в российской Арктике был бы трудным, если не невозможным, без поддержки Китая. Китай предоставил финансирование через свой Фонд Шелкового пути, займы от своих государственных политических банков и инвестиции через государственное предприятие.Китай также использовал Фонд Шелкового пути и другое государственное предприятие для инвестирования в Сибур, крупнейшую нефтехимическую компанию России. 14 Сотрудничество между правительствами имеет решающее значение для крупнейших инвестиций Китая в Россию, которая также пытается привлечь инвестиции из Японии, Индии и Саудовской Аравии.

Но риски России остаются слишком высокими, а ее выгоды слишком низкими, чтобы привлечь многих частных инвесторов. На пути к увеличению инвестиций стоят условия ведения бизнеса в России и слабые рыночные основы.Проблема заключается не просто в неприятии риска китайскими инвесторами, которые были готовы пробираться в одни из самых сложных условий ведения бизнеса в мире, часто под знаменем BRI. Россия более рискованна, чем развитые страны, но менее перспективна, чем многие развивающиеся страны, отчасти из-за сокращения численности населения.

Вместо того, чтобы наметить новую главу для инвестиций, BRI столкнулся со старыми проблемами. Совместные списки проектов объявлялись в прошлом и часто попадают в заголовки газет, но в конечном итоге реализовано очень мало проектов.В 2009 году Ху Цзиньтао и Дмитрий Медведев заявили о более 200 совместных проектах. Пять лет спустя фактически прогрессировали менее 10 процентов. 15 В 2014 и 2015 годах в России было создано 20 особых экономических зон (ОЭЗ) для привлечения иностранных инвестиций на Дальний Восток. Только шесть из них привлекли китайские инвестиции, которые в период с 2015 по 2018 год составили всего 38 миллионов долларов. Все те же проблемы — бюрократизм, плохая инфраструктура и коррупция — все еще остаются. 16

Как и вся статистика BRI, любые оценки участия России в этих усилиях требуют внимательного отношения.Один флагманский проект BRI, высокоскоростная железная дорога Москва-Казань, неоднократно откладывался и, как и другие проекты, предшествовал объявлению BRI. Его астрономическая цена — 22 миллиарда долларов — завышает общие оценки проектной деятельности BRI в России. В марте российские официальные лица объявили, что проект будет «отложен». 17

Неудивительно, если проект отложат на неопределенный срок. У российских и китайских официальных лиц мало стимулов для публичного прекращения совместных проектов, особенно тех, которые приобрели символическое значение.

Стратегическая осторожность может ограничить некоторые формы инвестиций. Завершено лишь несколько трансграничных проектов, в первую очередь два моста на Дальнем Востоке России и трубопровод «Сила Сибири». Трубопроводы стратегически важны и экономически важны для России. Еще одно преимущество заключается в том, что они не могут перевозить людей, не говоря уже о вооруженных силах. Долгая история конкуренции и недоверия делает недавнее потепление в китайско-российских отношениях сегодня еще более поразительным. Но у этого есть пределы.Россия может решить сохранить слабыми трансграничные транспортные связи в качестве защиты от растущих возможностей Китая.

Обе стороны стремятся уменьшить свою зависимость от западных финансовых систем. Китай и Россия начали использовать свои собственные валюты для двусторонней торговли в 2010 году и открыли свою первую линию валютных свопов в 2014 году. Центральный банк России переместил часть резервов из долларов в евро и юань, но частные компании и домохозяйства в России менее склонны отказываться от этого. доллар.Китайский юань используется более широко, чем российский рубль, но по-прежнему используется менее чем для двух процентов платежей во всем мире. 18 Должностные лица также обсуждали возможность установления связи между национальными платежными системами Китая и России в течение нескольких лет. Здесь снова очевиден дисбаланс между партнерами. Карты UnionPay Китая можно использовать во всем мире, в то время как Россия изо всех сил пытается заставить свою карточную систему «Мир» работать на международном уровне. 19

Сотрудничество в области цифровых платежей расширяется, но остается ограниченным из-за сравнительно небольшого размера российского рынка и отвращения к цифровой валюте.В прошлом году Yandex.Checkout, совместное предприятие технологической компании Яндекс и Сбербанка, крупнейшего банка России, стало первым интернет-магазином в России, принимающим WeChat Pay. Китайская компания AliPay работает над созданием совместного предприятия с Mail.ru, чтобы предлагать российским пользователям услуги цифровых платежей. 20 Правительство Китая проводит испытания своей цифровой валюты, электронного юаня, в четырех городах Китая. Глава Центробанка России Эльвира Набиуллина выразила сомнения в необходимости цифровой валюты. 21 Но если Россия будет двигаться вперед, она, вероятно, предпочтет многие из тех же функций, которые дают китайским чиновникам контроль над своим цифровым предложением.

Усилия Китая и России по созданию альтернатив системе SWIFT, базирующейся в Брюсселе, только зарождаются, но примечательны. Китай добился большего успеха в привлечении международного участия к своей версии, системе трансграничных межбанковских платежей (CIPS). По состоянию на апрель 2020 года CIPS имеет участников в 95 странах. 22 Российская версия Системы передачи финансовых сообщений (SFPS) была расширена только в прошлом году за счет включения в нее членов ЕАЭС. 23 После Японии Россия занимает второе место по количеству банков, использующих китайскую платежную систему CIPS. 24 Западные санкции являются основной движущей силой этих альтернатив, которые заслуживают большего внимания и осторожности со стороны политиков США.

Люди

До недавнего времени межличностные связи были одной из наиболее перспективных областей сотрудничества между Китаем и Россией. С момента открытия советско-китайской границы в 1988 году российские официальные лица и СМИ предупреждали о «китаизации» российского Дальнего Востока. 25 Хотя эти опасения преувеличены, они время от времени всплывают на поверхность, часто в интересах внутренней политической повестки дня, как и ксенофобия в других местах. В последние годы эти предупреждения были в значительной степени заглушены согласованными усилиями по развитию отношений со стороны обоих правительств.

Улучшение восприятия наиболее ярко проявляется среди россиян. Согласно опросу Pew, проведенному в прошлом году в 34 странах, самые положительные рейтинги Китая были получены от граждан России. Среди российских респондентов 71 процент положительно относятся к Китаю, и только 18 процентов придерживаются отрицательного мнения, что является одним из самых низких отрицательных рейтингов.Сопоставимых данных о восприятии России Китаем нет, но китайские государственные СМИ агрессивно продвигают партнерство как внутри страны, так и за ее пределами. В статье «Синьхуа» о визите Си в Москву в прошлом году, характерной для этого толчка, подчеркивается «беспроигрышное сотрудничество, добрососедство и гармоничное сосуществование». 26

Эти впечатления важны для торговых и инвестиционных связей. Улучшение национального родства и языка может оказать положительное влияние на торговлю и инвестиции, эффективно минимизируя культурную «дистанцию» между странами.В конце концов, вести бизнес становится легче, когда вы понимаете собеседника. Некоторые преимущества уже очевидны. В 2019 году Россию посетили более двух миллионов китайских туристов по сравнению с 158000 десятью годами ранее и потратили более 1 миллиарда долларов. 27 Слабая валюта России помогла привлечь китайских туристов, равно как и политика правительства, в том числе упрощение визовых требований и поощрение туристических агентств к увеличению количества посещений.

Расширение этих связей приносит прямые выгоды обеим сторонам, но также усиливает зависимость России от Китая.По оценкам российской туристической ассоциации, китайские туристы составляют почти 30 процентов туризма в России. 28 В отличие от Китая, рынок туризма намного больше, а Россия не входит в число основных источников иностранных туристов. Как и другие формы взаимозависимости, то, что является благом, когда отношения идут хорошо, может стать помехой, если отношения ухудшатся. В рамках своего инструментария экономического управления государством Китай продемонстрировал готовность использовать туризм в принудительном порядке, например, сократив количество посещений Южной Кореи в 2017 году.

Covid-19 выявил массовую враждебность и недоверие, а также подчеркнул решимость Китая и России поддерживать устойчивые отношения между ними. К разочарованию китайских официальных лиц, в январе Россия закрыла границу с Китаем. Власти Москвы преследуют этнических китайцев для задержания и возможной депортации. 29 Согласно опросу IPSOS, проведенному в феврале, более трети россиян заявили, что будут избегать контактов с людьми китайского происхождения или внешности. 30 По аналогичным данным, они не будут покупать китайские товары, а китайские предприятия на российской стороне границы несут огромные убытки. 31

Китайские официальные лица публично возражали против некоторых действий России, но в целом их сдержали. Китай оказал России медицинскую помощь и не занял жесткую позицию по отношению к другим странам. Например, после того, как Австралия призвала к расследованию происхождения пандемии, Китай поднял барьеры для австралийской сельскохозяйственной продукции.Это различие показывает приоритеты Пекина и их понимание Москвой. Западные страны бросили вызов реакции Пекина на кризис, уважая граждан Китая. Для сравнения: Россия плохо обращалась с китайскими гражданами, но избегала вопросов, которые могли поставить под угрозу легитимность китайских официальных лиц.

Данные

Китай и Россия углубляют свое сотрудничество в области телекоммуникаций, но, как это ни парадоксально, сходство их правительств ограничивает потоки данных.Эти совместные усилия не новы. Россия была одним из первых зарубежных рынков, на которые вышла компания Huawei. Huawei создала совместное предприятие в 1997 году и, несмотря на то, что в течение нескольких лет практически не добивалась успеха, она решила остаться на российском рынке, несмотря на то, что многие западные компании уходили. Прорыв произошел в 2001 году, когда российская правительственная делегация посетила Китай. К 2003 году Россия была одним из ведущих рынков Huawei. 32

Официальные связи снова стимулируют сотрудничество в области цифровой инфраструктуры. 33 О решении России использовать оборудование Huawei в своих испытаниях 5G было объявлено как раз в тот момент, когда китайская фирма подвергалась более пристальному вниманию на западных рынках. Сделка была подписана во время визита Си в Москву в 2019 году, что еще раз подчеркивает ее символическое значение. Несмотря на фанфары, Россия все еще рассматривает другие варианты своей сети 5G и должна решить несколько проблем, включая распределение спектра. Huawei может в конечном итоге сыграть меньшую роль, чем предполагает церемония подписания Си и Путина. Россия также не делает выбор в пользу Huawei: все или ничего.Ему может быть выгодно хеджирование и использование комбинации разных поставщиков.

Китай и Россия также сотрудничают в разработке альтернативных глобальных навигационных спутниковых систем, которые имеют как коммерческое, так и военное применение. Российская система ГЛОНАСС была разработана во время холодной войны, но не достигла своей эксплуатационной емкости в 24 спутника до 1995 года. Китайская спутниковая сеть BeiDou была завершена в июне и, как утверждается, имеет более 400 миллионов пользователей в 120 странах. 34 В 2015 году Китай и Россия создали комитет для координации этих усилий и подписали в 2018 году соглашение о повышении совместимости и функциональной совместимости. 35 Они провели испытания оборудования на транспортных маршрутах «Пояс и Дорога» и согласились разместить базовые станции друг друга. Эти системы и спутниковая связь в целом дополняют наземные и подводные кабели, по которым передается подавляющее большинство данных во всем мире.

Несмотря на эти области сотрудничества, потоки данных между двумя странами ограничены их неизменным предпочтением государственного контроля. Семь из восьми международных наземных кабелей дальней связи Китая проходят через Россию.Если бы деловая и политическая среда в России была более благоприятной, она могла бы служить более крупным коммуникационным узлом между Европой и Китаем. Но взгляды Китая и России на «интернет-суверенитет» ограничивают трансграничную деятельность. Обе страны требуют, среди прочего, хранения личных данных внутри страны и установки приложений на домашнем оборудовании. 36 Российские сети менее централизованы и их труднее подвергать цензуре, чем китайские, но российское правительство безошибочно движется в направлении усиления контроля. 37

Фьючерсы и трение

Си и Путин предприняли, как они утверждают, долгосрочные усилия по большей экономической интеграции. Как объяснил Путин в прошлом году: «Я думаю, что если мы объединим усилия уже созданных агентств, организаций и даже концепций и создадим интегрированную сеть, мы сможем прийти к тому, о чем я неоднократно говорил, — к большому евразийскому партнерству. Может ли все это начаться в ближайшее время? Едва ли.» 38 Предложение Путина о «Большом евразийском партнерстве» и предложения «связать» BRI и ЕАЭС служат непосредственной политической цели.Но они упускают из виду экономические основы, которые могут вызвать еще больше трений в предстоящие годы.

На пути глубокой интеграции стоят серьезные структурные барьеры. Торговля и инвестиции ограничены российской экономикой, уловленной одним трюком, и ее осознанием того, что глубокая интеграция будет иметь серьезные разрушительные последствия. Государственная пропаганда может укрепить связи между людьми, но только до определенной степени, и, хотя два соседа имеют общую границу, сохраняются глубоко укоренившиеся культурные различия, которые усугубляются пандемией.Общее предпочтение Китая и России контролировать информацию ограничивает потоки данных.

В совокупности эти факторы показывают партнерство неравных, которое в будущем станет еще более однобоким. Китай уже возвышается над Россией почти во всех измерениях, и, если он сможет справиться с собственными внутренними проблемами, через десятилетие он станет еще больше. В течение этого периода Пекин будет нуждаться в помощи Москвы или, по крайней мере, в ее согласии, чтобы продолжить свою экспансию на запад. Ни одна страна не находится в лучшем положении, чем Россия, чтобы испортить сухопутные амбиции Китая.Но у России, изолированной от Запада, мало альтернатив углублению экономических связей с Китаем.

Даже через десять лет может быть неясно, в какой степени партнерство Китая и России зависит от авторитарных личностей, стоящих в его центре. В 2030 году Си и Путину будет 77 и 78 лет соответственно. Если они останутся у власти, неожиданные события могут стать испытанием для их личных отношений. Смена руководства в Центральной Азии может вызвать беспорядки и разногласия в Москве и Пекине по поводу того, как реагировать.«Один пояс, один путь» Китая, вероятно, получит более острые военные преимущества, поскольку Китай стремится защитить свои инвестиции и персонал за рубежом, в том числе в Центральной Азии.

Вероятность того, что Россия снова может склониться к Западу и уйти от Китая, в настоящее время кажется надуманной. Китай недостаточно опасен, а Запад достаточно гостеприимен. Но по мере того, как Китай все глубже уходит на задний двор России, расчет Москвы может измениться. Более серьезной задачей России будет искупить свое поведение за границей и убедить Запад, особенно Соединенные Штаты, возобновить свою деятельность.Союзники США, особенно в Европе и Японии, имеют более сильные экономические стимулы для участия. Учитывая эти различия, Соединенным Штатам следует тесно сотрудничать со своими союзниками, чтобы обеспечить координацию любых экономических стимулов (и сдерживающих факторов) для достижения максимального эффекта. 39

Соединенные Штаты и их союзники должны также подчеркнуть риски, которые несет экспансия Китая на запад, и защитить силу западных финансовых систем. В публичных заявлениях правительству США следует избегать преувеличения глубины и сплоченности китайско-российского партнерства.Объединение их в одну кучу слишком великодушно для России, особенно с экономической точки зрения, и звучит как музыка для обоих авторитарных лидеров. Политики США также должны более осторожно подходить к санкциям. 40 Неправильное использование этих защитных мер, особенно без последовательной наступательной стратегии, ослабляет западные финансовые системы и побуждает другие страны рассматривать альтернативы.

Несмотря на глубокие изъяны в своих экономических взглядах, Си и Путин выдвигают идеи, которые призваны найти отклик в третьих странах, особенно в развивающихся странах.В ответ на эти события самое меньшее, что могут сделать Соединенные Штаты и их союзники, — это избежать непреднамеренного сближения Китая и России. Еще более мощным ответом была бы совместная работа, чтобы предложить совместное видение экономического развития и поддержать его финансовой поддержкой, чтобы стимулировать участие и добиться ощутимых результатов. Лучший ответ на глобальные амбиции Си и Путина — предложить лучшие альтернативы.

Джонатан Э. Хиллман — директор проекта Reconnecting Asia в Центре стратегических и международных исследований в Вашингтоне, округ Колумбия.C., и автор книги The Emperor’s New Road: China and the Project of the Century (Yale University Press, 2020).

Этот отчет стал возможным благодаря общей поддержке CSIS. Данный отчет не спонсировался напрямую.

Этот отчет подготовлен Центром стратегических и международных исследований (CSIS), частным освобожденным от налогов учреждением, занимающимся вопросами международной государственной политики. Его исследования являются беспристрастными и непатентованными.CSIS не занимает определенных политических позиций. Соответственно, следует понимать, что все взгляды, позиции и выводы, выраженные в данной публикации, принадлежат исключительно автору (авторам).

© 2020 Центр стратегических и международных исследований. Все права защищены.

См. Ссылки в PDF-файле.

Управление по финансированию устойчивого развития | UN DESA

Управление по финансированию устойчивого развития

Управление оказывает согласованную и комплексную поддержку государствам-членам в решении вопросов, связанных с финансированием развития, а также в средствах реализации для достижения Повестки дня в области устойчивого развития на период до 2030 года.

Управление обеспечивает, чтобы межправительственные процессы по финансированию развития, включая Форум по финансированию развития, Форум сотрудничества в целях развития и соответствующие вспомогательные органы ЭКОСОС, работали согласованным и взаимоусиливающим образом.

Офис также оказывает поддержку Генеральному секретарю в координации участия представителей Организации Объединенных Наций в процессах G20, а также в других глобальных экономических и финансовых учреждениях и форумах.

Подпрограмма играет критически важную роль в поддержке различных рабочих потоков для мобилизации средств реализации Повестки дня в области устойчивого развития на период до 2030 года, укрепления сотрудничества Организации Объединенных Наций с другими международными организациями в области налогово-бюджетных вопросов и оказания комплексной аналитической поддержки Генеральный секретарь.

Г-н Навид Ханиф, директор

Основные виды деятельности

  • Служит координатором для согласованной, эффективной, всеобъемлющей и полностью интегрированной основной и организационной поддержки процессов финансирования развития;
  • Готовит ориентированный на практические действия анализ политики и конкретные предложения и рекомендации по финансированию устойчивого развития и средствам реализации, опираясь на сильные стороны межучрежденческого опыта и опыта системы развития Организации Объединенных Наций;
  • вносит вклад в согласованные подходы Организации Объединенных Наций к глобальным финансовым вопросам, в том числе посредством поддержки взаимодействия Организации Объединенных Наций с Группой 20;
  • Служит центром системы Организации Объединенных Наций для работы в области международного сотрудничества в целях развития и международного сотрудничества в налоговых вопросах;
.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *